| IED ID | IndEnz0002000984 |
| Enzyme Type ID | protease000984 |
| Protein Name |
Phosphocarrier protein NPr Nitrogen-related HPr |
| Gene Name | ptsO PMI3644 |
| Organism | Proteus mirabilis (strain HI4320) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Morganellaceae Proteus Proteus mirabilis Proteus mirabilis (strain HI4320) |
| Enzyme Sequence | MTQYRRVAIKNRLGMHARPAMKLFDLVNTFQSTVTLRNHEGVEAQADSVIAMLMLDSEQGSHIDIEASGCDEKEAIDAIIALFESGFDED |
| Enzyme Length | 90 |
| Uniprot Accession Number | Q9ZA86 |
| Absorption | |
| Active Site | ACT_SITE 16; /note=Pros-phosphohistidine intermediate; /evidence=ECO:0000255|PROSITE-ProRule:PRU00681 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the phosphoenolpyruvate-dependent nitrogen-metabolic phosphotransferase system (nitrogen-metabolic PTS), that seems to be involved in regulating nitrogen metabolism. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein NPr by enzyme I-Ntr. Phospho-NPr then transfers it to EIIA-Ntr. Could function in the transcriptional regulation of sigma-54 dependent operons in conjunction with the NPr (PtsO) and EIIA-Ntr (PtsN) proteins. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Sequence conflict (3) |
| Keywords | Cytoplasm;Phosphotransferase system;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 10,014 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |