| IED ID | IndEnz0002001016 |
| Enzyme Type ID | protease001016 |
| Protein Name |
Subtilisin BL EC 3.4.21.62 Alkaline protease |
| Gene Name | |
| Organism | Lederbergia lentus (Bacillus lentus) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Lederbergia Lederbergia lentus (Bacillus lentus) |
| Enzyme Sequence | AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR |
| Enzyme Length | 269 |
| Uniprot Accession Number | P29599 |
| Absorption | |
| Active Site | ACT_SITE 32; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU01240; ACT_SITE 62; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU01240; ACT_SITE 215; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU01240 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins with broad specificity for peptide bonds, and a preference for a large uncharged residue in P1. Hydrolyzes peptide amides.; EC=3.4.21.62; |
| DNA Binding | |
| EC Number | 3.4.21.62 |
| Enzyme Function | FUNCTION: Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (13); Chain (1); Domain (1); Helix (9); Metal binding (9); Turn (2) |
| Keywords | 3D-structure;Calcium;Hydrolase;Metal-binding;Protease;Secreted;Serine protease;Sporulation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1ST3; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,824 |
| Kinetics | |
| Metal Binding | METAL 2; /note=Calcium 1; METAL 40; /note=Calcium 1; METAL 73; /note=Calcium 1; via carbonyl oxygen; METAL 75; /note=Calcium 1; METAL 77; /note=Calcium 1; via carbonyl oxygen; METAL 79; /note=Calcium 1; via carbonyl oxygen; METAL 163; /note=Calcium 2; via carbonyl oxygen; METAL 165; /note=Calcium 2; via carbonyl oxygen; METAL 168; /note=Calcium 2; via carbonyl oxygen |
| Rhea ID | |
| Cross Reference Brenda |