| IED ID | IndEnz0002001046 |
| Enzyme Type ID | protease001046 |
| Protein Name |
Spanin, inner membrane subunit i-spanin Gene product 18.5 Gp18.5 |
| Gene Name | 18.5 |
| Organism | Escherichia phage T7 (Bacteriophage T7) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Autographiviridae Studiervirinae Teseptimavirus Escherichia virus T7 Escherichia phage T7 (Bacteriophage T7) |
| Enzyme Sequence | MLEFLRKLIPWVLAGMLFGLGWHLGSDSMDAKWKQEVHNEYVKRVEAAKSTQRAIDAVSAKYQEDLAALEGSTDRIISDLRSDNKRLRVRVKTTGTSDGQCGFEPDGRAELDDRDAKRILAVTQKGDAWIRALQDTIRELQRK |
| Enzyme Length | 143 |
| Uniprot Accession Number | P03803 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the spanin complex that disrupts the host outer membrane and participates in cell lysis during virus exit. The spanin complex conducts the final step in host lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans. Host outer membrane disruption is possibly due to local fusion between the inner and outer membrane performed by the spanin complex. {ECO:0000305|PubMed:17900620}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Topological domain (2); Transmembrane (1) |
| Keywords | Cytolysis;Host cell inner membrane;Host cell lysis by virus;Host cell membrane;Host membrane;Hydrolase;Membrane;Protease;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix;Viral release from host cell |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Host cell inner membrane {ECO:0000305|PubMed:17900620}; Single-pass type II membrane protein {ECO:0000305|PubMed:17900620}; Periplasmic side {ECO:0000305|PubMed:17900620}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,243 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |