| IED ID | IndEnz0002001077 |
| Enzyme Type ID | protease001077 |
| Protein Name |
Vitellin-degrading protease EC 3.4.21.- Cleaved into: Beta-VTN protease; Alpha-VTN protease chain 1; Alpha-VTN protease chain 2 |
| Gene Name | |
| Organism | Bombyx mori (Silk moth) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Amphiesmenoptera Lepidoptera (butterflies and moths) Glossata Neolepidoptera Heteroneura Ditrysia Obtectomera Bombycoidea (hawk-moths) Bombycidae (silkworm moths) Bombycinae Bombyx Bombyx mori (Silk moth) |
| Enzyme Sequence | MTNSLLICFTILGLAASSPTKPIGDIRIVGGEDIVITEAPYQVSVMFRGAHSCGGTLVAADIVVTAAHCVMSFAPEDYRIRVGSSFHQRDGMLYDVGDLAWHPDFNFASMDNDIAILWLPKPVMFGDTVEAIEMVETNSEIPDGDITIVTGWGHMEEGGGNPSVLQRVIVPKINEAACAEAYSPIYAITPRMLCAGTPEGGKDACQGDSGGPLVHKKKLAGIVSWGLGCARPEYPGVYTKVSALREWVDENITNLRLKHILRRF |
| Enzyme Length | 264 |
| Uniprot Accession Number | Q07943 |
| Absorption | |
| Active Site | ACT_SITE 68; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 113; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 209; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | BINDING 203; /note=Substrate; /evidence=ECO:0000250 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Responsible for the degradation of vitellin in eggs at the head pigmentation stage. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Binding site (1); Chain (3); Disulfide bond (3); Domain (1); Glycosylation (1); Propeptide (1); Sequence conflict (3); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Cleavage after Arg-27 leads to beta-VTN protease and subsequent cleavage after Arg-89 leads to alpha-VTN. |
| Signal Peptide | SIGNAL 1..15; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,521 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |