| IED ID | IndEnz0002001126 |
| Enzyme Type ID | protease001126 |
| Protein Name |
Ubiquitin carboxyl-terminal hydrolase nonstop EC 3.4.19.12 Deubiquitinating enzyme nonstop Ubiquitin thioesterase nonstop Ubiquitin-specific-processing protease nonstop |
| Gene Name | not CG4166 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MSETGCRHYQSYVKEHSYDTFRVIDAYFAACVNRDARERKAIHCNCFECGSYGIQLYACLHCIYFGCRGAHITSHLRSKKHNVALELSHGTLYCYACRDFIYDARSREYALINRKLEAKDLQKSIGWVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYHKNVLEYE |
| Enzyme Length | 496 |
| Uniprot Accession Number | Q9VVR1 |
| Absorption | |
| Active Site | ACT_SITE 167; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU01035; ACT_SITE 450; /note=Proton acceptor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01035 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. Catalyzes the deubiquitination of histone H2B, thereby acting as a coactivator in a large subset of genes. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad. {ECO:0000269|PubMed:11182084, ECO:0000269|PubMed:18188155, ECO:0000269|PubMed:18206972}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Domain (1); Erroneous gene model prediction (1); Erroneous initiation (1); Metal binding (12); Zinc finger (1) |
| Keywords | Activator;Chromatin regulator;Hydrolase;Metal-binding;Nucleus;Protease;Reference proteome;Thiol protease;Transcription;Transcription regulation;Ubl conjugation pathway;Zinc;Zinc-finger |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10471706; 10518988; 11102377; 11476870; 12593986; 12767830; 15454543; 15474165; 15998724; 17849284; 18516287; 18550751; 19279664; 19609321; 20008933; 20220848; 20440302; 20800474; 20813047; 21764853; 22253573; 22426530; 22937016; 22989713; 23071443; 23275879; 23298642; 23899565; 24493646; 24705267; 24912630; 25027767; 25168387; 25195504; 25312911; 25313405; 25483136; 25779050; 26120032; 26550828; 26577379; 27185460; 27261002; 27960592; 28887412; 29995556; 30333215; 30635270; 31068592; 31348003; 31538360; 31722958; 31724732; 31794428; 31810838; 32512004; 32660023; 32735945; 32739556; 32911111; 33087840; 33629655; 33988679; 7672606; 7857635; |
| Motif | |
| Gene Encoded By | |
| Mass | 56,441 |
| Kinetics | |
| Metal Binding | METAL 6; /note=Zinc 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 8; /note=Zinc 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 46; /note=Zinc 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 49; /note=Zinc 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 59; /note=Zinc 3; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 62; /note=Zinc 3; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 67; /note=Zinc 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 71; /note=Zinc 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 75; /note=Zinc 3; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 81; /note=Zinc 3; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 94; /note=Zinc 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 97; /note=Zinc 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502 |
| Rhea ID | |
| Cross Reference Brenda |