| IED ID | IndEnz0002001154 |
| Enzyme Type ID | protease001154 |
| Protein Name |
20 kDa protein p20 |
| Gene Name | ORF7 |
| Organism | Beet yellows virus (isolate Ukraine) (BYV) (Sugar beet yellows virus) |
| Taxonomic Lineage | Viruses Riboviria Orthornavirae Kitrinoviricota Alsuviricetes Martellivirales Closteroviridae Closterovirus Beet yellows virus Beet yellows virus (isolate Ukraine) (BYV) (Sugar beet yellows virus) |
| Enzyme Sequence | MTSSVELAQTKPLFRVLLLKGFVFYVVAFETEEESSEAELPLVYLHDFELNINKRGKIEASYVDFMSCMTRLKPSSVSYTRVSSEKSSEDFSLPGSGKTFGSKVLNRKVTFTFENGVQLVFGMYGLEQRCVSSDYLWFENVFVGAHCGTLTYCLNCELDKSGGELEILTFSKNEVLLKRW |
| Enzyme Length | 180 |
| Uniprot Accession Number | Q08544 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in systemic transport. Necessary for long-distance transport of the virus through the phloem. {ECO:0000269|PubMed:12368343}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Reference proteome;Transport;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000269|PubMed:12368343, ECO:0000269|PubMed:15044703}. Note=Integral virion tail component. Presumably associates with the virion via binding to Hsp70h. Probably builts the tip segment of the virion tail. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,418 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |