| IED ID | IndEnz0002001192 |
| Enzyme Type ID | protease001192 |
| Protein Name |
RHOMBOID-like protein 10, chloroplastic AtRBL10 EC 3.4.21.- |
| Gene Name | RBL10 RBL8 At1g25290 F4F7.32 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MVSVSLSHHNLWPPESGSTAFRGFATAASVHACHHVSRHLRLDFHLRSSLKKLQHFSDDARMKFARYQRVFVFNGANFLKSRVDIRLSQSSPFVCFFNGGESRLNPRGGEEGSSNPETSKRNTVNGRRWTNVLLAINVIMYIAQIASDGKVLTWGAKINSLIERGQLWRLATASVLHANPMHLMINCYSLNSIGPTAESLGGPKRFLAVYLTSAVAKPILRVLGSAMSYWFNKAPSVGASGAIFGLVGSVAVFVIRHKQMVRGGNEDLMQIAQIIALNMAMGLMSRRIDNWGHIGGLLGGTAMTWLLGPQWKYEYTTRDGRRVFMDSAPIPLLLRWRNEQRRL |
| Enzyme Length | 343 |
| Uniprot Accession Number | F4ICF4 |
| Absorption | |
| Active Site | ACT_SITE 240; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:P54493; ACT_SITE 293; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P54493 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Rhomboid-type serine protease that catalyzes intramembrane proteolysis (PubMed:22416142, PubMed:22738221). Required for correct root growth, floral development, fertility and photoprotection (PubMed:22416142). May be involved in TIC22 processing during its import and in AOS accumulation in the chloroplast membrane (PubMed:22738221). {ECO:0000269|PubMed:22416142, ECO:0000269|PubMed:22738221}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Alternative sequence (1); Chain (1); Erroneous gene model prediction (1); Transit peptide (1); Transmembrane (6) |
| Keywords | Alternative splicing;Chloroplast;Hydrolase;Membrane;Plastid;Protease;Reference proteome;Transit peptide;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: Up-regulated by cold during seedling germination. {ECO:0000305|PubMed:22416142}. |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast membrane {ECO:0000269|PubMed:22416142, ECO:0000269|PubMed:22738221}; Multi-pass membrane protein {ECO:0000255}. Note=Localizes probably to the inner membrane. {ECO:0000303|PubMed:22738221}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18543065; 20736450; 31062431; |
| Motif | |
| Gene Encoded By | |
| Mass | 38,222 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.105; |