| IED ID | IndEnz0002001193 |
| Enzyme Type ID | protease001193 |
| Protein Name |
Rhomboid-like protein 11, chloroplastic AtRBL11 EC 3.4.21.- |
| Gene Name | RBL11 RBL9 At5g25752 T5I5 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSQLLHLHRLSLPQSSLRFRFPPLHRRRAASSPTNSTQPPLQFRPLTVSRSQITCRFSQSDITPQFELDKAKDNRKPQKRANGIFWIILINLGIYLADHFFQVRGIKSLYLYHNFPAWYQFVTATFCHANWNHLSSNLFFLYIFGKLVEEEEGNFGLWLSYLFTGVGANLVSWLVLPRNAVSVGASGAVFGLFAISVLVKMSWDWRKILEVLILGQFVIERVMEAAQASAGLSGTIYGGYSLQTVNHIAHLSGALVGVVLVWLLSKFPSASMDQDVKKSS |
| Enzyme Length | 280 |
| Uniprot Accession Number | Q84MB5 |
| Absorption | |
| Active Site | ACT_SITE 186; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:P54493; ACT_SITE 250; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P54493 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Rhomboid-type serine protease that catalyzes intramembrane proteolysis. May be involved in TIC22 processing during its import. {ECO:0000269|PubMed:22738221}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Topological domain (6); Transit peptide (1); Transmembrane (5) |
| Keywords | Chloroplast;Hydrolase;Membrane;Plastid;Plastid inner membrane;Protease;Reference proteome;Transit peptide;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast inner membrane {ECO:0000269|PubMed:18543065, ECO:0000269|PubMed:22738221}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 31062431; |
| Motif | |
| Gene Encoded By | |
| Mass | 31,593 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |