| IED ID | IndEnz0002001250 |
| Enzyme Type ID | protease001250 |
| Protein Name |
RHOMBOID-like protein 12, mitochondrial AtRBL12 EC 3.4.21.- Presenilins-associated rhomboid-like protein |
| Gene Name | RBL12 PARL At1g18600 F25I16.6 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MKAIFNRRVVVDSSSRLTKLLANPTTHSHLNRQTFTSLYKPNQSRHFRTHYLPSSPSSPPVSRFDPSQLWRSEKIRGFFASALGNKAVKLGNLVESRVGFIGSQFPKKGFEFQRFSGFQRRGWKHWLQGLSDRDVVLGLVIANAGVFVMWRVFNQQFMMNNFMISLDNFKSGRLHTLITSAFSHIDIGHIVSNMIGLYFFGTSIARNFGPQFLLKLYLAGALGGSVFYLIHHAYMAATSPKGQGAFVRDPSRTPGLGASGAVNAIMLLDIFLHPRATLYLEFFIPVPAMLLGIFLIGKDILRITEGNSNISGSAHLGGAAVAAIAWARIRKGRFRF |
| Enzyme Length | 336 |
| Uniprot Accession Number | Q9FZ81 |
| Absorption | |
| Active Site | ACT_SITE 259; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:P54493; ACT_SITE 315; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P54493 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis. Unable to cleave either of the yeast Pcp1 substrates in yeast cells. {ECO:0000269|PubMed:18543065}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Transit peptide (1); Transmembrane (6) |
| Keywords | Hydrolase;Membrane;Mitochondrion;Protease;Reference proteome;Transit peptide;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion membrane {ECO:0000269|PubMed:18543065, ECO:0000269|PubMed:22738221}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18650403; |
| Motif | |
| Gene Encoded By | |
| Mass | 37,441 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |