| IED ID | IndEnz0002001294 |
| Enzyme Type ID | protease001294 |
| Protein Name |
Miraculin MIR |
| Gene Name | |
| Organism | Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids Ericales Sapotaceae Chrysophylloideae Synsepalum Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica) |
| Enzyme Sequence | MKELTMLSLSFFFVSALLAAAANPLLSAADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF |
| Enzyme Length | 220 |
| Uniprot Accession Number | P13087 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (4); Glycosylation (2); Sequence conflict (1); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Signal;Taste-modifying protein |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated; contains as much as 13,9% of sugars (glucosamine, mannose, galactose, xylose, and fucose). {ECO:0000269|PubMed:2335505}. |
| Signal Peptide | SIGNAL 1..29; /evidence="ECO:0000269|PubMed:2708331, ECO:0000269|PubMed:3403544" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,367 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |