| IED ID | IndEnz0002001295 |
| Enzyme Type ID | protease001295 |
| Protein Name |
UBA domain-containing protein Mud1 EC 3.4.23.- DNA-damage-inducible protein DDI1 homolog UBA domain-containing protein 1 |
| Gene Name | mud1 ddi1 ucp1 SPAC56F8.08 |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota Taphrinomycotina Schizosaccharomycetes Schizosaccharomycetales Schizosaccharomycetaceae Schizosaccharomyces Schizosaccharomyces pombe (Fission yeast) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Enzyme Sequence | MNNLTPENIRQTILATPFLLNRIRTEFPQLAAVLNDPNAFATTWQSINASQLLQIPSSTYSMGMPSFSEDDLFDVEVQRRIEEQIRQNAVTENMQSAIENHPEVFGQVYMLFVNVEINGHKVKAFVDSGAQATILSADCAEKCGLTRLLDTRFQGVAKGVGMAKILGCVHSAPLKIGDLYLPCRFTVIEGRDVDMLLGLDMLRRYQACIDLENNVLRIHGKEIPFLGESEIPKLLANVEPSANAHGLGIEPASKASASSPNPQSGTRLGTKESVAPNNEGSSNPPSLVNPPTDPGLNSKIAQLVSMGFDPLEAAQALDAANGDLDVAASFLL |
| Enzyme Length | 332 |
| Uniprot Accession Number | Q10256 |
| Absorption | |
| Active Site | ACT_SITE 127; /evidence=ECO:0000250|UniProtKB:Q5TDH0 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Recognizes and binds polyubiquitin chains (PubMed:11584278, PubMed:16138082). Acts as a linker between the 19S proteasome and polyubiquitinated proteins via UBA domain interactions with ubiquitin for their subsequent degradation. Aspartic protease. Appears to act as negative regulator of constitutive exocytosis. May act at the level of secretory vesicle docking and fusion as a competitive inhibitor of SNARE assembly. Required for S-phase checkpoint control (By similarity). {ECO:0000250|UniProtKB:P40087, ECO:0000269|PubMed:11584278, ECO:0000269|PubMed:16138082}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Compositional bias (1); Domain (1); Helix (3); Mutagenesis (1); Region (1); Site (13); Turn (1) |
| Keywords | 3D-structure;Aspartyl protease;Cell membrane;Cytoplasm;Hydrolase;Membrane;Protease;Protein transport;Reference proteome;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P40087}. Cell membrane {ECO:0000250|UniProtKB:P40087}; Peripheral membrane protein {ECO:0000250|UniProtKB:P40087}; Cytoplasmic side {ECO:0000250|UniProtKB:P40087}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1Z96; |
| Mapped Pubmed ID | 20473289; 21712547; 23697806; 26412298; 29996109; 30726745; |
| Motif | |
| Gene Encoded By | |
| Mass | 35,870 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |