| IED ID | IndEnz0002001300 |
| Enzyme Type ID | protease001300 |
| Protein Name |
NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 2, mitochondrial Complex I-AGGG CI-AGGG NADH-ubiquinone oxidoreductase AGGG subunit |
| Gene Name | NDUFB2 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED |
| Enzyme Length | 105 |
| Uniprot Accession Number | O95178 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. {ECO:0000269|PubMed:27626371}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1); Transit peptide (1) |
| Keywords | 3D-structure;Direct protein sequencing;Electron transport;Membrane;Mitochondrion;Mitochondrion inner membrane;Reference proteome;Respiratory chain;Transit peptide;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000305|PubMed:12611891}; Peripheral membrane protein {ECO:0000305}; Matrix side {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | Electron microscopy (4) |
| Cross Reference PDB | 5XTC; 5XTD; 5XTH; 5XTI; |
| Mapped Pubmed ID | 11695836; 12231006; 12837546; 14718445; 14741580; 15250827; 16230336; 19064571; 20552642; 20877624; 21924235; 21988832; 23270816; 24191001; 28844695; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,058 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |