| IED ID | IndEnz0002001349 |
| Enzyme Type ID | protease001349 |
| Protein Name |
Small ubiquitin-related modifier 3-like SUMO-3-A |
| Gene Name | sumo3l sumo3 sumo3a zgc:65847 zgc:85643 |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Otomorpha Ostariophysi Otophysi Cypriniphysae Cypriniformes (carps and others) Cyprinoidei Danionidae Danioninae Danio Danio rerio (Zebrafish) (Brachydanio rerio) |
| Enzyme Sequence | MSEDKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSC |
| Enzyme Length | 94 |
| Uniprot Accession Number | Q6NV25 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex sae1-sae2 and linkage to the E2 enzyme ube2i (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Cross-link (2); Domain (1); Propeptide (1) |
| Keywords | Cytoplasm;Isopeptide bond;Nucleus;Reference proteome;Ubl conjugation;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus, PML body {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Polymeric chains can be formed through Lys-11 cross-linking. {ECO:0000250}.; PTM: Cleavage of precursor form by a sentrin-specific protease is necessary for function. {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 19704416; 25757417; |
| Motif | |
| Gene Encoded By | |
| Mass | 10,683 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |