| IED ID | IndEnz0002001374 |
| Enzyme Type ID | protease001374 |
| Protein Name |
Probable thylakoidal processing peptidase 2, chloroplastic EC 3.4.21.89 Signal peptidase I-2 |
| Gene Name | TPP2 At1g06870 F4H5.6 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAIRVTFTYSSYVARSIASSAGTRVGTGDVRSCFETWVRPRFCGHNQIPDIVDKSPGSNTWGPSSGPRARPASSMYSTIAREILEEGCKSPLVLGMISLMNLTGAPQFSGMTGLGISPFKTSSVIPFLRGSKWMPCSIPATLSTDIAEVDRGGKVCDPKVKLELSDKVSNGGNGWVNKLLNICSEDAKAAFTAVTVSLLFRSALAEPKSIPSTSMLPTLDVGDRVIAEKVSYFFRKPEVSDIVIFKAPPILVEHGYSCADVFIKRIVASEGDWVEVCDGKLLVNDTVQAEDFVLEPIDYEMEPMFVPEGYVFVLGDNRNKSFDSHNWGPLPIKNIIGRSVFRYWPPSKVSDIIHHEQVSQKRAVDVS |
| Enzyme Length | 367 |
| Uniprot Accession Number | Q9M9Z2 |
| Absorption | |
| Active Site | ACT_SITE 214; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.; EC=3.4.21.89; |
| DNA Binding | |
| EC Number | 3.4.21.89 |
| Enzyme Function | FUNCTION: Cleaves the thylakoid-transfer domain from a chloroplast protein. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Region (1); Sequence conflict (2); Topological domain (1); Transit peptide (2); Transmembrane (1) |
| Keywords | Chloroplast;Hydrolase;Membrane;Plastid;Protease;Reference proteome;Thylakoid;Transit peptide;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast thylakoid membrane; Single-pass membrane protein. Note=located in the non-appressed lamellae of the thylakoid network. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12185496; 16895613; 18775970; 22087276; 27247031; |
| Motif | |
| Gene Encoded By | |
| Mass | 40,150 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |