| IED ID | IndEnz0002001388 |
| Enzyme Type ID | protease001388 |
| Protein Name |
Tail tip assembly protein K Probable endopeptidase EC 3.4.-.- Tail assembly protein K |
| Gene Name | K lambdap19 |
| Organism | Escherichia phage lambda (Bacteriophage lambda) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Siphoviridae (phages with long non-contractile tails) Lambdavirus Escherichia phage lambda (Bacteriophage lambda) |
| Enzyme Sequence | MSPEDWLQAEMQGEIVALVHSHPGGLPWLSEADRRLQVQSDLPWWLVCRGTIHKFRCVPHLTGRRFEHGVTDCYTLFRDAYHLAGIEMPDFHREDDWWRNGQNLYLDNLEATGLYQVPLSAAQPGDVLLCCFGSSVPNHAAIYCGDGELLHHIPEQLSKRERYTDKWQRRTHSLWRHRAWRASAFTGIYNDLVAASTFV |
| Enzyme Length | 199 |
| Uniprot Accession Number | P03729 |
| Absorption | |
| Active Site | ACT_SITE 73; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU01284; ACT_SITE 139; /note=Proton acceptor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01284; ACT_SITE 151; /evidence=ECO:0000255|PROSITE-ProRule:PRU01284 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Plays a role in tail tip complex assembly. The tail tip complex is assembled successively with three tail tip proteins J, one tail tip protein I, one tail tip protein L and one tail tip protein K. The tail tip complex interacts with tail measure protein to initiate tail tube assembly. The formation of the tail tip complex is completed by the addition of tail tip protein M, which is followed by tail tube polymerization. May be excluded form tail tip during maturation and would be absent from virions. May be involved in tail measure protein processing. {ECO:0000269|PubMed:1003470}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Domain (2); Metal binding (3); Motif (1) |
| Keywords | Host cytoplasm;Hydrolase;Late protein;Metal-binding;Metalloprotease;Protease;Reference proteome;Thiol protease;Viral release from host cell;Viral tail assembly;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Host cytoplasm. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 21943085; |
| Motif | MOTIF 20..33; /note=JAMM motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Gene Encoded By | |
| Mass | 23,011 |
| Kinetics | |
| Metal Binding | METAL 20; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 22; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 33; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Rhea ID | |
| Cross Reference Brenda |