| IED ID | IndEnz0002001435 |
| Enzyme Type ID | protease001435 |
| Protein Name |
Peptidoglycan endopeptidase RipB EC 3.4.-.- Macrophage invasion and intracellular persistence protein B Resuscitation-promoting factor interaction partner B Rpf-interacting protein B |
| Gene Name | ripB Rv1478 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Enzyme Sequence | MRHTRFHPIKLAWITAVVAGLMVGVATPADAEPGQWDPTLPALVSAGAPGDPLAVANASLQATAQATQTTLDLGRQFLGGLGINLGGPAASAPSAATTGASRIPRANARQAVEYVIRRAGSQMGVPYSWGGGSLQGPSKGVDSGANTVGFDCSGLVRYAFAGVGVLIPRFSGDQYNAGRHVPPAEAKRGDLIFYGPGGGQHVTLYLGNGQMLEASGSAGKVTVSPVRKAGMTPFVTRIIEY |
| Enzyme Length | 241 |
| Uniprot Accession Number | P9WHU5 |
| Absorption | |
| Active Site | ACT_SITE 152; /note="Nucleophile"; /evidence="ECO:0000255|PROSITE-ProRule:PRU01284, ECO:0000269|PubMed:21864539"; ACT_SITE 201; /note="Proton acceptor"; /evidence="ECO:0000255|PROSITE-ProRule:PRU01284, ECO:0000269|PubMed:21864539"; ACT_SITE 213; /evidence="ECO:0000255|PROSITE-ProRule:PRU01284, ECO:0000305|PubMed:21864539" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Peptidoglycan endopeptidase that cleaves the bond between D-glutamate and meso-diaminopimelate. Binds high-molecular weight peptidoglycan, but does not degrade it. Required for normal separation of daughter cells after cell division and cell wall integrity. Required for host cell invasion. {ECO:0000269|PubMed:16495549}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6. {ECO:0000269|PubMed:21864539}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (8); Chain (1); Domain (1); Helix (10); Mutagenesis (1); Signal peptide (1); Turn (3) |
| Keywords | 3D-structure;Cell wall biogenesis/degradation;Hydrolase;Protease;Reference proteome;Signal;Thiol protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..31; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 3PBI; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,624 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |