| IED ID | IndEnz0002001446 |
| Enzyme Type ID | protease001446 |
| Protein Name |
NEDD8-specific protease 1 EC 3.4.22.- Deneddylase-1 |
| Gene Name | NEDP1 DEN1 At5g60190 F15L12.8 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MGNTSDDDKILSYEDVVLRRSDLDILNGPIFLNDRVIEFYLSFLSTVHSSTTISLIPPSIAFWISNCPDTEYLKDFMKPLNLRDKDLLILPVNDNSNVEVAEGGLHWSLLVYYKEANTFVHHDSYMGVNRWSAKQLFKAVSPFVSNGDASYKECTDTPQQKNGYDCGVFLLATARVICEWFSSGGMKNRDELWFANVKETVPDLVNHLREEILALIKKLMSESVSK |
| Enzyme Length | 226 |
| Uniprot Accession Number | Q9LSS7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Processes the pre-form of the ubiquitin-like protein NEDD8/RUB1. Has the capacity to discriminate between NEDD8/RUB1 and ubiquitin. Has no SUMO protease activity. {ECO:0000269|PubMed:16920872}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Hydrolase;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14507998; 16581939; 25783028; 28096463; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,684 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |