| IED ID | IndEnz0002001501 |
| Enzyme Type ID | protease001501 |
| Protein Name |
Putative sporulation sigma factor-processing peptidase EC 3.4.23.- Fragment |
| Gene Name | |
| Organism | Bacillus thuringiensis subsp. kurstaki |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus cereus group Bacillus thuringiensis Bacillus thuringiensis subsp. kurstaki |
| Enzyme Sequence | FSKKRIESVEVTKIHYDQIVKVKIQLAEEELELAGLIDSGNQLYDPLTKTPVMIMHVSSLEHCLPSWLTEQIYSKTEIPQIPENDSGWATKLRLIPFRAVGVESQFLWAIKPDSVQVDHEGSSIVVNKVLIGLNTQQLSTNGEYQCIVHPKMLISQKMVIA |
| Enzyme Length | 161 |
| Uniprot Accession Number | P26767 |
| Absorption | |
| Active Site | ACT_SITE 38; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Probably activates the RNA polymerase sigma-35 factor at the stage II of sporulation. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Non-terminal residue (1) |
| Keywords | Aspartyl protease;Hydrolase;Protease;Sporulation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,182 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |