| IED ID | IndEnz0002001529 |
| Enzyme Type ID | protease001529 |
| Protein Name |
Secreted phosphoprotein 24 Spp-24 Secreted phosphoprotein 2 |
| Gene Name | SPP2 SPP24 |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MEKMAMKMLVIFVLGMNHWTCTGFPVYDYDPASLKEALSASVAKVNSQSLSPYLFRAFRSSVKRVNALDEDSLTMDLEFRIQETTCRRESEADPATCDFQRGYHVPVAVCRSTVRMSAEQVQNVWVRCHWSSSSGSSSSEEMFFGDILGSSTSRNSYLLGLTPDRSRGEPLYEPSREMRRNFPLGNRRYSNPWPRARVNPGFE |
| Enzyme Length | 203 |
| Uniprot Accession Number | Q27967 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Could coordinate an aspect of bone turnover. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Modified residue (5); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Phosphoprotein;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 90; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q13103; MOD_RES 138; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q62740; MOD_RES 139; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q62740; MOD_RES 166; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q8K1I3; MOD_RES 175; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q62740 |
| Post Translational Modification | PTM: Multiply phosphorylated at serine residues in Ser-X-Glu/Ser(P) sequences, a recognition motif for phosphorylation by secretory pathway protein kinase.; PTM: Phosphorylation sites are present in the extracellular medium. {ECO:0000250}. |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000269|PubMed:7814406 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18075815; 20615094; 22949401; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,134 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |