| IED ID | IndEnz0002001530 |
| Enzyme Type ID | protease001530 |
| Protein Name |
Serine proteinase inhibitor 1 Serp-1 Serpin-1 |
| Gene Name | SPI-1 CPXV217 |
| Organism | Cowpox virus (strain Brighton Red) (CPV) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Cowpox virus (CPV) Cowpox virus (strain Brighton Red) (CPV) |
| Enzyme Sequence | MDIFKELILKHTDENVLISPVSILSTLSILNHGAAGSTAEQLSKYIENKNTPKDDKDDNNDMDVDIPYCATLATANKIYCSDSIEFHASFLQKIKDDFQTVNFNNANQTKELINEWVKTMTNGKINSLLTTPLPINTRMTVVSAVHFKAMWKYPFSKHLTYTDKFYISKNIVTSVDMMVSTKNDLQYVHINELFGGFSIIDIPYEGNSSMVIILPDDIEGLYNIEKHITDENFKKWCSKLSTKSIDLYMPKFKVEMTEPYNLVPILENLGLTNIFGYYSDFSKMCNETITVEKFLHKTFIDVNEEYTEASAITGVFMTNFSMVYRTKVYINHPFMYMIKDNTGRILFIGKYCYPQ |
| Enzyme Length | 355 |
| Uniprot Accession Number | P42927 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This viral protein may be involved in the regulation of the complement cascade. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous initiation (2); Site (1) |
| Keywords | Host cytoplasm;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Host cytoplasm {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 40,870 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |