| IED ID | IndEnz0002001534 |
| Enzyme Type ID | protease001534 |
| Protein Name |
Signal peptide peptidase-like 2A SPP-like 2A SPPL2a EC 3.4.23.- Intramembrane protease 3 IMP-3 Presenilin-like protein 2 |
| Gene Name | Sppl2a Imp3 Psl2 MNCb-3763 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MGLLHSLHAPAAALLWSCLLGLAAAQEAILHASTNGVSSLSKDYCMYYNNNWTRLPSSLENATSLSLMNLTGTALCHLSDIPPDGIRNKAVVVHWGPCHFLEKARIAQEGGAAALLIANNSVLIPSSRNKSTFQNVTVLIAVITQKDFKDMKETLGDDITVKMYSPSWPNFDYTLVVIFVIAVFTVALGGYWSGLIELENMKSVEDAEDRETRKKKDDYLTFSPLTVVVFVVICCIMIVLLYFFYRWLVYVMIAIFCIASSMSLYNCLSALIHRMPCGQCTILCCGKNIKVSLIFLSGLCISVAVVWAVFRNEDRWAWILQDILGIAFCLNLIKTMKLPNFMSCVILLGLLLIYDVFFVFITPFITKNGESIMVELAAGPFENAEKLPVVIRVPKLMGYSVMSVCSVPVSVLGFGDIIVPGLLIAYCRRFDVQTGSSIYYISSTIAYAVGMIITFVVLMVMKTGQPALLYLVPCTLITVSVVAWSRKEMKKFWKGSSYQVMDHLDYSTNEENPVTTDEQIVQQ |
| Enzyme Length | 523 |
| Uniprot Accession Number | Q9JJF9 |
| Absorption | |
| Active Site | ACT_SITE 355; /evidence=ECO:0000250|UniProtKB:P49810; ACT_SITE 416; /evidence=ECO:0000250|UniProtKB:P49810 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane. Functions in FASLG, ITM2B and TNF processing. Catalyzes the intramembrane cleavage of the anchored fragment of shed TNF-alpha (TNF), which promotes the release of the intracellular domain (ICD) for signaling to the nucleus. Also responsible for the intramembrane cleavage of Fas antigen ligand FASLG, which promotes the release of the intracellular FasL domain (FasL ICD). May play a role in the regulation of innate and adaptive immunity. {ECO:0000250|UniProtKB:Q8TCT8}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Domain (1); Glycosylation (6); Motif (2); Mutagenesis (2); Sequence conflict (3); Signal peptide (1); Topological domain (10); Transmembrane (9) |
| Keywords | Endosome;Glycoprotein;Hydrolase;Lysosome;Membrane;Protease;Reference proteome;Signal;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Late endosome membrane {ECO:0000269|PubMed:21896273}; Multi-pass membrane protein {ECO:0000305}. Lysosome membrane {ECO:0000269|PubMed:21896273}; Multi-pass membrane protein {ECO:0000305}. Membrane {ECO:0000250|UniProtKB:Q8TCT8}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q8TCT8}; Lumenal side {ECO:0000250|UniProtKB:Q8TCT8}. Note=Colocalizes with palmitoylated and myristoylated proteins at the plasma membrane. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated. {ECO:0000250|UniProtKB:P49768}. |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000250|UniProtKB:Q8TCT8 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 14610273; 16141072; 18799693; 21267068; 23267013; 23267015; 23267016; 23426979; 24492962; 24872421; 26157172; 26987812; 28550201; 30127434; 30733281; 30819724; 33239420; |
| Motif | MOTIF 466..468; /note=PAL; MOTIF 498..501; /note=YXXo lysosomal targeting motif |
| Gene Encoded By | |
| Mass | 58,129 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.23.B24; |