| IED ID | IndEnz0002001535 |
| Enzyme Type ID | protease001535 |
| Protein Name |
Serine protease inhibitor 2 PSPI-21 PSPI-21-5.2 Cleaved into: Serine protease inhibitor 2 chain A; Serine protease inhibitor 2 chain B |
| Gene Name | |
| Organism | Solanum tuberosum (Potato) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) |
| Enzyme Sequence | LPSDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLGYNLLYCPVTSSSDDQFCSKVGVVHQNGKRRLALVNENPLDVLFQEV |
| Enzyme Length | 186 |
| Uniprot Accession Number | P58515 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Potent inhibitor of serine proteases (chymotrypsin and trypsin). Inhibits tightly human leukocyte elastase (HLE). Does not inhibit papain, pepsin nor cathepsin D (cysteine and aspartic proteases). Protects the plant by inhibiting proteases of invading organisms, decreasing both hyphal growth and zoospores germination of Phytophthora infestans. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Disulfide bond (2); Non-adjacent residues (1); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Serine protease inhibitor;Vacuole |
| Interact With | |
| Induction | INDUCTION: By infection with Phytophthora infestans. |
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Probably synthesized as a single-chain precursor which is cleaved to form chain A and chain B. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,116 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |