| IED ID | IndEnz0002001549 |
| Enzyme Type ID | protease001549 |
| Protein Name |
Serpin-ZX ArathZx AtSerpin1 Serpin-1 |
| Gene Name | At1g47710 F16N3.3 T2E6.22 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MDVRESISLQNQVSMNLAKHVITTVSQNSNVIFSPASINVVLSIIAAGSAGATKDQILSFLKFSSTDQLNSFSSEIVSAVLADGSANGGPKLSVANGAWIDKSLSFKPSFKQLLEDSYKAASNQADFQSKAVEVIAEVNSWAEKETNGLITEVLPEGSADSMTKLIFANALYFKGTWNEKFDESLTQEGEFHLLDGNKVTAPFMTSKKKQYVSAYDGFKVLGLPYLQGQDKRQFSMYFYLPDANNGLSDLLDKIVSTPGFLDNHIPRRQVKVREFKIPKFKFSFGFDASNVLKGLGLTSPFSGEEGLTEMVESPEMGKNLCVSNIFHKACIEVNEEGTEAAAASAGVIKLRGLLMEEDEIDFVADHPFLLVVTENITGVVLFIGQVVDPLH |
| Enzyme Length | 391 |
| Uniprot Accession Number | Q9S7T8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits metacaspase-9 (MC9) cysteine protease. Functions through cleavage of its reactive center loop and covalent binding to MC9. Involved in the control of elicitor-stimulated programmed cell death (PCD). During infection by the necrotrophic fungal pathogen Botrytis cinerea, functions to protect cells by limiting the PCD-promoting protease RD21A activity that is released from the ER body or vacuole to the cytoplasm (PubMed:23398119). Involved in the control of water stress-induced cell death by limiting the pro-death protease RD21A activity that is released from the vacuole to the cytoplasm (PubMed:26884487). {ECO:0000269|PubMed:17028019, ECO:0000269|PubMed:23398119, ECO:0000269|PubMed:26884487}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (16); Chain (1); Glycosylation (1); Helix (15); Mutagenesis (3); Region (1); Site (1); Turn (6) |
| Keywords | 3D-structure;Apoplast;Cytoplasm;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, apoplast {ECO:0000269|PubMed:17028019}. Cytoplasm {ECO:0000269|PubMed:23398119}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 3LE2; |
| Mapped Pubmed ID | 12169696; 15341633; 16463051; 18796151; 18805951; 21655276; 22085334; 22947050; 27247031; 27315833; 28157265; 28179567; 29954869; |
| Motif | |
| Gene Encoded By | |
| Mass | 42,639 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |