IED ID |
IndEnz0002001593 |
Enzyme Type ID |
protease001593 |
Protein Name |
Cell division inhibitor SulA
|
Gene Name |
sulA Ctu_15660 |
Organism |
Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032) |
Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Enterobacteriaceae
Cronobacter
Cronobacter turicensis
Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
|
Enzyme Sequence |
MYFSHQNRAHGSRRLAKETADALAQAETRGLISEVMYNEDQPRMTQMVLLPLLQQLGLQSRWQLWLTPQQRLSREWVESAGLPLTKVMQVSQMNPQVTLDSMIRALETGNYSVVIAWLHDDLTDDEHRRLTEAAEKGNAMGFLMRPVQPSLPGDRPRSGLRIHSRMVH |
Enzyme Length |
168 |
Uniprot Accession Number |
C9Y0Q0 |
Absorption |
|
Active Site |
|
Activity Regulation |
|
Binding Site |
|
Calcium Binding |
|
catalytic Activity |
|
DNA Binding |
|
EC Number |
|
Enzyme Function |
FUNCTION: Component of the SOS system and an inhibitor of cell division. Accumulation of SulA causes rapid cessation of cell division and the appearance of long, non-septate filaments. In the presence of GTP, binds a polymerization-competent form of FtsZ in a 1:1 ratio, thus inhibiting FtsZ polymerization and therefore preventing it from participating in the assembly of the Z ring. This mechanism prevents the premature segregation of damaged DNA to daughter cells during cell division. {ECO:0000255|HAMAP-Rule:MF_01179}. |
Temperature Dependency |
|
PH Dependency |
|
Pathway |
|
nucleotide Binding |
|
Features |
Chain (1); Erroneous initiation (1); Region (2); Site (1) |
Keywords |
Cell cycle;Cell division;DNA damage;SOS response;Septation |
Interact With |
|
Induction |
INDUCTION: By DNA damage, as part of the SOS response. {ECO:0000255|HAMAP-Rule:MF_01179}. |
Subcellular Location |
|
Modified Residue |
|
Post Translational Modification |
PTM: Is rapidly cleaved and degraded by the Lon protease once DNA damage is repaired. {ECO:0000255|HAMAP-Rule:MF_01179}. |
Signal Peptide |
|
Structure 3D |
|
Cross Reference PDB |
- |
Mapped Pubmed ID |
- |
Motif |
|
Gene Encoded By |
|
Mass |
19,270 |
Kinetics |
|
Metal Binding |
|
Rhea ID |
|
Cross Reference Brenda |
|