| IED ID | IndEnz0002001602 |
| Enzyme Type ID | protease001602 |
| Protein Name |
Subtilisin inhibitor-like protein 4 SIL-4 SIL4 |
| Gene Name | |
| Organism | Streptomyces lavendulae |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces lavendulae |
| Enzyme Sequence | APDAAPASLYAPSALVLTIGHGGAAATATPERAVTLTCAPTSSGTHPAASAACAELRGVGGDFAALKARDDVWCNKLYDPVVVTAQGVWQGQRVSYERTFGNSCERDAVGGSLFAF |
| Enzyme Length | 116 |
| Uniprot Accession Number | P29609 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of subtilisin BPN' and trypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,784 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |