| IED ID |
IndEnz0002001603 |
| Enzyme Type ID |
protease001603 |
| Protein Name |
Staphylococcal superantigen-like 10
|
| Gene Name |
ssl10 SAOUHSC_00395 |
| Organism |
Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Staphylococcaceae
Staphylococcus
Staphylococcus aureus
Staphylococcus aureus (strain NCTC 8325 / PS 47)
|
| Enzyme Sequence |
MKFTALAKATLALGILTTGTLTTEVHSGHAKQNQKSVNKHDKEALYRYYTGKTMEMKNISALKHGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQEKRDKHDIFYTVGGVIQNNKTSGVVSAPILNISKEKGEDAFVKGYPYYIKKEKITLKELDYKLRKHLIEKYGLYKTISKDGRVKISLKDGSFYNLDLRSKLKFKYMGEVIESKQIKDIEVNLK |
| Enzyme Length |
227 |
| Uniprot Accession Number |
Q2G2X7 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Plays a role in the inhibition of host complement activation via the classical pathway by interacting with the Fc region of human IgG and thereby interfering with the IgG/C1q interaction (PubMed:19913916). Inhibits also the penultimate step of plasma clotting by interacting with prothrombin/F2 and coagulation factor X/F12. Does not affect the protease activity of thrombin but interferes with the conversion of prothrombin to thrombin (PubMed:23754290, PubMed:28193526). Interacts with human receptor CXCR4 and specifically inhibits CXCL12-induced calcium mobilization and cell migration (PubMed:19308288). {ECO:0000269|PubMed:19308288, ECO:0000269|PubMed:19913916, ECO:0000269|PubMed:23754290, ECO:0000269|PubMed:28193526}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Beta strand (13); Chain (1); Helix (4); Signal peptide (1); Turn (1) |
| Keywords |
3D-structure;Reference proteome;Secreted;Signal;Virulence |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q2G1S8}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..30; /evidence=ECO:0000255 |
| Structure 3D |
X-ray crystallography (2) |
| Cross Reference PDB |
6LWT;
6UCD;
|
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
26,111 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|