| IED ID | IndEnz0002001629 |
| Enzyme Type ID | protease001629 |
| Protein Name |
Proteasome activator 28 PA28 homolog |
| Gene Name | psmE3 dpr1 DDB_G0285099 |
| Organism | Dictyostelium discoideum (Slime mold) |
| Taxonomic Lineage | cellular organisms Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia (dictyostelid cellular slime molds) Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) |
| Enzyme Sequence | MSKNNSTVIKMDEQVLKYKEDLYEKTVHHLKVTIPKKIAEYQELAKSYGQNSENEQDGQTSKKRKLDSEDYVLMPIEDLIKTNRVIMETHQKFKKAYIELIETFSVIRGWISLNIPRIEDGNNFGVDVQEDIITQITKLEEVYTSLLDGSESYFASRASLVKKILKHKDIEAYRYSLAQVDEKEFTRFSFSYFDLANNYATTYSLIVKNFAKLETPRPTNASNIY |
| Enzyme Length | 225 |
| Uniprot Accession Number | Q967U1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Subunit of the 11S REG (also called PA28) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates preferentially the trypsin-like catalytic subunit of the proteasome. May also be involved in cell cycle regulation. {ECO:0000269|PubMed:19411624}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Nucleus;Proteasome;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:19411624}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,226 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |