| IED ID | IndEnz0002001640 |
| Enzyme Type ID | protease001640 |
| Protein Name |
Selenoprotein S SelS |
| Gene Name | SELENOS SELS |
| Organism | Sus scrofa (Pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
| Enzyme Sequence | MEQDGDQLSARPALETEGLRFLHVTVGSLLATYGWYIVFCCILLYVVFQKLSTRLRALRQRHLDGAAAALEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEEKRRQKIERWDSVQEGRSYRGDARKRQEEDSPGPSTSSVIPKRKSDKKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG |
| Enzyme Length | 190 |
| Uniprot Accession Number | F1SR90 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination (By similarity). {ECO:0000250|UniProtKB:Q9BQE4}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Erroneous termination (1); Modified residue (1); Non-standard residue (1); Region (2); Transmembrane (1) |
| Keywords | Cytoplasm;Endoplasmic reticulum;Membrane;Phosphoprotein;Reference proteome;Selenocysteine;Transmembrane;Transmembrane helix;Ubl conjugation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:21116851}. Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q9BQE4}; Single-pass membrane protein {ECO:0000250|UniProtKB:Q9BQE4}. |
| Modified Residue | MOD_RES 140; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q9BQE4 |
| Post Translational Modification | PTM: Truncated SELENOS proteins produced by failed UGA/Sec decoding are ubiquitinated by the CRL2(KLHDC2) and CRL2(KLHDC3) complexes, which recognizes the glycine (Gly) at the C-terminus of truncated SELENOS proteins. Truncated SELENOS proteins produced by failed UGA/Sec decoding are also ubiquitinated by the CRL5(KLHDC1) complex. {ECO:0000250|UniProtKB:Q9BQE4}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,279 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |