| IED ID | IndEnz0002001657 |
| Enzyme Type ID | protease001657 |
| Protein Name |
Securin Cell untimely torn protein 2 Protein Cut2 |
| Gene Name | cut2 SPBC14C8.01c SPBC1815.02c |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota Taphrinomycotina Schizosaccharomycetes Schizosaccharomycetales Schizosaccharomycetaceae Schizosaccharomyces Schizosaccharomyces pombe (Fission yeast) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Enzyme Sequence | MLPRTMFSYGKENAFPVTPISNRNGTKGAGSKRAPLGSTKQSNAPSSVTVPRTVLGGKSTNISKFISAPSTKKMSPMDISMDSPTILEPNSQGISRSAVQERSKRLSASPRRSSLTDTPLPNELEEDIEYMPPPVHLDPIQSLGFDDVAIDCETLDPWPSMQNKATSVTIRNTPASDFHVYKEFSDDDPIQFPLLSVDGDSPLTEKDTNLTTPATLKASDQQRKVLEKPSVSKQSSSRTRLSTVYRTKLASGKSIPRPLSHKLTRPRVTASGNSRRRPLSRSIHSLSSSRIDFSSLDTGLL |
| Enzyme Length | 301 |
| Uniprot Accession Number | P21135 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Regulatory protein, which plays a central role in chromosome stability. Probably acts by blocking the action of key proteins. During the mitosis, it blocks separase/cut1 function, preventing the proteolysis of the cohesin complex and the subsequent segregation of the chromosomes. At the onset of anaphase, it is ubiquitinated, conducting to its destruction and to the liberation of cut1. {ECO:0000269|PubMed:8632802, ECO:0000269|PubMed:9312055}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (3); Motif (2); Mutagenesis (2); Region (3); Repeat (2) |
| Keywords | Cell cycle;Cell division;Chromosome partition;Cytoplasm;Mitosis;Nucleus;Reference proteome;Repeat;Ubl conjugation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. Nucleus. |
| Modified Residue | |
| Post Translational Modification | PTM: Ubiquitinated by the anaphase promoting complex (APC) at the onset of anaphase, conducting to its degradation. {ECO:0000269|PubMed:9312055}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12553909; 15161942; 15329725; 16453724; 16483313; 17178839; 20473289; 21712547; 22645648; 23697806; 24763107; 26527280; 26882497; 29996109; 30072439; 30726745; 8978688; 9635190; |
| Motif | MOTIF 33..36; /note=D-box 1; MOTIF 52..55; /note=D-box 2 |
| Gene Encoded By | |
| Mass | 32,854 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |