| IED ID | IndEnz0002001687 |
| Enzyme Type ID | protease001687 |
| Protein Name |
Metalloproteinase inhibitor 2 Tissue inhibitor of metalloproteinases 2 TIMP-2 Fragment |
| Gene Name | TIMP2 TIMP-2 |
| Organism | Equus caballus (Horse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Perissodactyla (odd-toed ungulates) Equidae (horses) Equus Equus Equus caballus (Horse) |
| Enzyme Sequence | KAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKADGNGKMHITLCDFIVPWDTLST |
| Enzyme Length | 91 |
| Uniprot Accession Number | O77717 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Non-terminal residue (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Reference proteome;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: The activity of TIMP2 is dependent on the presence of disulfide bonds. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,998 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |