| IED ID | IndEnz0002001702 |
| Enzyme Type ID | protease001702 |
| Protein Name |
Metalloproteinase inhibitor 3 Tissue inhibitor of metalloproteinases 3 TIMP-3 |
| Gene Name | timp3 |
| Organism | Xenopus laevis (African clawed frog) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) |
| Enzyme Sequence | MSVCALTLILGCFLLFLGDISKPAEGCTCAPSHPQDAFCNSDIVIRAKVVGKKLMKDGPFGTMRYTVKQMKMYRGFNKMPQVQYIYTEASESLCGVKLEVNKYQYLITGRVYEGKVYTGLCNLIERWEKLTFAQRKGLNHRYPLGCTCKIKPCYYLPCFITSKNECLWTDMLSNFGYPGYQSKNYACIKQKEGYCSWYRGWAPPDKTTINTTDP |
| Enzyme Length | 214 |
| Uniprot Accession Number | O73746 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (6); Domain (1); Metal binding (1); Region (2); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Extracellular matrix;Metal-binding;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Secreted;Signal;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,456 |
| Kinetics | |
| Metal Binding | METAL 27; /note=Zinc; via amino nitrogen and carbonyl oxygen; shared with metalloproteinase partner; /evidence=ECO:0000250|UniProtKB:P16035 |
| Rhea ID | |
| Cross Reference Brenda |