| IED ID | IndEnz0002001747 |
| Enzyme Type ID | protease001747 |
| Protein Name |
Trypsin inhibitor 1 SFTI-1 |
| Gene Name | sfti1 |
| Organism | Helianthus annuus (Common sunflower) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Asteroideae Heliantheae alliance Heliantheae Helianthus Helianthus annuus (Common sunflower) |
| Enzyme Sequence | MATTMAKLITLVVLAILAFVEVSVSGYKTSISTITIEDNGRCTKSIPPICFPDGRP |
| Enzyme Length | 56 |
| Uniprot Accession Number | Q4GWU5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin, cathepsin G, elastase, chymotrypsin and thrombin. Does not inhibit factor Xa. {ECO:0000269|PubMed:10390350}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (3); Cross-link (1); Disulfide bond (1); Peptide (1); Propeptide (2); Signal peptide (1); Site (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: This is a cyclic peptide. {ECO:0000269|PubMed:10390350}. |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000255 |
| Structure 3D | NMR spectroscopy (17); X-ray crystallography (17) |
| Cross Reference PDB | 1JBL; 1JBN; 1O8Y; 1O8Z; 1SFI; 1T9E; 2AB9; 3P8F; 4ABI; 4ABJ; 4HGC; 4K1E; 4K8Y; 4KEL; 4XOJ; 6BVH; 6BVU; 6BVW; 6BVX; 6BVY; 6D3X; 6D3Y; 6D3Z; 6D40; 6Q1U; 6U22; 6U24; 6U7Q; 6U7R; 6U7S; 6U7U; 6U7X; 6VXY; 6VY8; |
| Mapped Pubmed ID | 15667208; 21693064; 22374650; 24598736; 26212347; 27767076; 29605997; 30520638; 30668585; 31058493; 32270580; |
| Motif | |
| Gene Encoded By | |
| Mass | 5,971 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |