| IED ID | IndEnz0002001767 |
| Enzyme Type ID | protease001767 |
| Protein Name |
Signal peptide peptidase-like 2B SPP-like 2B SPPL2b EC 3.4.23.- Intramembrane protease 4 IMP-4 Presenilin homologous protein 4 PSH4 Presenilin-like protein 1 |
| Gene Name | SPPL2B IMP4 KIAA1532 PSL1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MAAAVAAALARLLAAFLLLAAQVACEYGMVHVVSQAGGPEGKDYCILYNPQWAHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVALLSYKDMLDIFTRFGRTVRAALYAPKEPVLDYNMVIIFIMAVGTVAIGGYWAGSRDVKKRYMKHKRDDGPEKQEDEAVDVTPVMTCVFVVMCCSMLVLLYYFYDLLVYVVIGIFCLASATGLYSCLAPCVRRLPFGKCRIPNNSLPYFHKRPQARMLLLALFCVAVSVVWGVFRNEDQWAWVLQDALGIAFCLYMLKTIRLPTFKACTLLLLVLFLYDIFFVFITPFLTKSGSSIMVEVATGPSDSATREKLPMVLKVPRLNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRVYFVACTIAYGVGLLVTFVALALMQRGQPALLYLVPCTLVTSCAVALWRRELGVFWTGSGFAKVLPPSPWAPAPADGPQPPKDSATPLSPQPPSEEPATSPWPAEQSPKSRTSEEMGAGAPMREPGSPAESEGRDQAQPSPVTQPGASA |
| Enzyme Length | 592 |
| Uniprot Accession Number | Q8TCT7 |
| Absorption | |
| Active Site | ACT_SITE 359; /evidence=ECO:0000250|UniProtKB:P49810; ACT_SITE 421; /evidence=ECO:0000250|UniProtKB:P49810 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane. Functions in ITM2B and TNF processing (PubMed:16829952, PubMed:16829951, PubMed:17965014, PubMed:19114711, PubMed:22194595). Catalyzes the intramembrane cleavage of the anchored fragment of shed TNF-alpha (TNF), which promotes the release of the intracellular domain (ICD) for signaling to the nucleus (PubMed:16829952, PubMed:16829951). May play a role in the regulation of innate and adaptive immunity (PubMed:16829952). Catalyzes the intramembrane cleavage of the simian foamy virus processed leader peptide gp18 of the envelope glycoprotein gp130 dependently of prior ectodomain shedding by furin or furin-like proprotein convertase (PC)-mediated cleavage proteolysis (PubMed:23132852). {ECO:0000269|PubMed:16829951, ECO:0000269|PubMed:16829952, ECO:0000269|PubMed:17965014, ECO:0000269|PubMed:19114711, ECO:0000269|PubMed:22194595, ECO:0000269|PubMed:23132852}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Alternative sequence (3); Chain (1); Compositional bias (2); Domain (1); Erroneous gene model prediction (1); Erroneous initiation (2); Erroneous translation (1); Glycosylation (2); Motif (1); Mutagenesis (1); Natural variant (1); Region (1); Sequence caution (1); Signal peptide (1); Topological domain (10); Transmembrane (9) |
| Keywords | Alternative splicing;Cell membrane;Endosome;Glycoprotein;Golgi apparatus;Hydrolase;Lysosome;Membrane;Protease;Reference proteome;Signal;Transmembrane;Transmembrane helix |
| Interact With | Q8WUW1; Q01658; P29692-2; Q06787-7; Q00403; Q9Y5Q9; P04792; O60333-2; O60260-5; P60891; Q9Y3C5; P37840 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:16829952}; Multi-pass membrane protein {ECO:0000305}. Golgi apparatus membrane {ECO:0000269|PubMed:17965014}; Multi-pass membrane protein {ECO:0000305}. Lysosome membrane {ECO:0000269|PubMed:15998642}; Multi-pass membrane protein {ECO:0000305}. Endosome membrane {ECO:0000269|PubMed:15998642}; Multi-pass membrane protein {ECO:0000305}. Membrane {ECO:0000269|PubMed:15385547}; Multi-pass membrane protein {ECO:0000305}; Lumenal side {ECO:0000269|PubMed:15385547}. Note=targeted through the entire secretory pathway to endosomes/lysosomes (PubMed:15998642). {ECO:0000269|PubMed:15998642}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated (PubMed:15385547, PubMed:15998642). {ECO:0000269|PubMed:15385547, ECO:0000269|PubMed:15998642}. |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000269|PubMed:15385547 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18768471; 20711500; 23384347; 30819724; |
| Motif | MOTIF 472..474; /note=PAL |
| Gene Encoded By | |
| Mass | 64,644 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |