| IED ID | IndEnz0002001866 |
| Enzyme Type ID | protease001866 |
| Protein Name |
RNA polymerase sigma-G factor Stage III sporulation protein G |
| Gene Name | sigG spoIIIG BSU15330 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MSRNKVEICGVDTSKLPVLKNEEMRKLFRQLQDEGDDSAREKLVNGNLRLVLSVIQRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSHNVKFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDIAYKALQVRERLISETSKEPTAEDIAKVLEVPHEEIVFALDAIQDPVSLFEPIYNDGGDPIYVMDQISDERNTDSQWIEELALKEGMRRLNDREKMILRKRFFQGKTQMEVAEEIGISQAQVSRLEKAAIKQMNKNIHQ |
| Enzyme Length | 260 |
| Uniprot Accession Number | P19940 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Activity repressed by anti-sigma-G factor Gin (csfB) and Lon protease during the early stages of forespore development (PubMed:17921305). When both Gin and sigma-G are expressed in E.coli Gin inhibits sigma-G activity, strongly suggesting Gin inhibits by direct physical interaction (PubMed:19497328). {ECO:0000269|PubMed:17921305, ECO:0000269|PubMed:19497328}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 229..248; /note=H-T-H motif; /evidence=ECO:0000250 |
| EC Number | |
| Enzyme Function | FUNCTION: Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released (PubMed:18208527). This sigma factor is responsible for the expression of sporulation specific genes in the forespore (PubMed:18208527). {ECO:0000269|PubMed:18208527}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Motif (1); Region (1) |
| Keywords | DNA-binding;Reference proteome;Sigma factor;Sporulation;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: Expressed and active 2 hours after sporulation starts (at protein level); stimulates its own transcription (PubMed:18208527). {ECO:0000269|PubMed:18208527}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 67..80; /note=Polymerase core binding |
| Gene Encoded By | |
| Mass | 30,073 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |