| IED ID | IndEnz0002001924 |
| Enzyme Type ID | protease001924 |
| Protein Name |
Rhomboid-like protein 16, chloroplastic AtRBL16 |
| Gene Name | RBL16 At1g74130 F9E11.2 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MHAIFCRRVAVGCSSPQLTKLVTKQASQSRHSLSHLLPFDLSSRFVPPYVVSRSARVHGFFAGKLGNTNLKLKFGNVMESRAGFFSSELPSHGFESGGFTGFQKRGWKSWINGANGVVFGLVIANAAVFTMWRVLGKDNMWMVKNFMLSRYSFMTGRIHTLITSGFSHVGATHIILNMMGLCYFGARIARSFGPRYLLKLYFAGALGGSVFFLSSHALSVISLKGQRVVPKDQLKVPIGKLGANGPVYAITLLDMLLYPKVTTYFGLMLRVPVFAGIYSLGLNIIKMLEGKNNNTLTSLDQLGGVVVAVIAWARIRKGRFCY |
| Enzyme Length | 322 |
| Uniprot Accession Number | Q84WG3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Rhomboid-type serine protease that catalyzes intramembrane proteolysis. May cleave the plastid translocon component Tic40. {ECO:0000303|PubMed:17327256}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (1); Erroneous gene model prediction (1); Transit peptide (1); Transmembrane (6) |
| Keywords | Alternative splicing;Chloroplast;Hydrolase;Membrane;Plastid;Protease;Reference proteome;Transit peptide;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast membrane {ECO:0000255}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,451 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |