| IED ID | IndEnz0002001959 |
| Enzyme Type ID | protease001959 |
| Protein Name |
DNA-dependent metalloprotease dvc-1 EC 3.4.24.- DNA damage protein targeting VCP DVC1 Protein with SprT-like domain at the N terminus Spartan |
| Gene Name | dvc-1 T19B10.6 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MSRSSLVDPSFELSDPCPDIHALFIQFDARFFGGSLACCEVKWSPRMYACAGICSYEIRGGRGGLCSIRLSKPLLTLRPRSDLVETLLHEMIHAYLFVKERNRDRDGHGPQFQAHMHRINQAGGTNITIYHSFHDEVRLYKQHWWRCSGPCRDRRPFFGYVKRSCNRAPGPNDRWWSQHQQSCGGNFLKVKEPEGYGQGKGSKRTNDKNKSGGPALKKTITPPRVTLDDFFKKDGKNSSDNSTSKSPTKPSTSLFTGSGQKLGGSSSTSSLLNSYPKATQNSGGNRLGGTSGGVSRLLPPVNFTSPSSAPVAEQVIDLGDSDDDDFQDMDDDALEISFVASDNSVICPSCNTEVMENLIHGHLDYCLG |
| Enzyme Length | 368 |
| Uniprot Accession Number | Q22557 |
| Absorption | |
| Active Site | ACT_SITE 90; /evidence="ECO:0000250|UniProtKB:Q9H040, ECO:0000255|PROSITE-ProRule:PRU10095" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: DNA-dependent metalloendopeptidase that mediates the proteolytic cleavage of covalent DNA-protein cross-links (DPCs) during DNA synthesis, thereby playing a key role in maintaining genomic integrity (PubMed:27871365). DPCs are highly toxic DNA lesions that interfere with essential chromatin transactions, such as replication and transcription, and which are induced by reactive agents, such as UV light or formaldehyde (PubMed:27871365). Associates with the DNA replication machinery and specifically removes DPCs during DNA synthesis (PubMed:27871365). Regulator of UV-induced DNA damage response: required to protect genome stability during DNA replication, possibly via recruitment of vcp/p97 (cdc-48.1 or cdc-48.2) recruitment (PubMed:23042605). {ECO:0000269|PubMed:23042605, ECO:0000269|PubMed:27871365}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Compositional bias (2); Domain (1); Metal binding (7); Region (1); Zinc finger (1) |
| Keywords | Chromosome;DNA damage;DNA repair;Hydrolase;Metal-binding;Metalloprotease;Nucleus;Protease;Reference proteome;Zinc;Zinc-finger |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:23042605}. Chromosome {ECO:0000269|PubMed:23042605}. Note=Localizes to nuclear foci following UV treatment. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11231151; 12242227; 19123269; 21177967; 21367940; 21529718; 22560298; 23800452; 25487147; |
| Motif | |
| Gene Encoded By | |
| Mass | 40,566 |
| Kinetics | |
| Metal Binding | METAL 89; /note="Zinc 1; catalytic"; /evidence="ECO:0000250|UniProtKB:Q9H040, ECO:0000255|PROSITE-ProRule:PRU10095"; METAL 93; /note="Zinc 1; catalytic"; /evidence="ECO:0000250|UniProtKB:Q9H040, ECO:0000255|PROSITE-ProRule:PRU10095"; METAL 108; /note="Zinc 1; catalytic"; /evidence="ECO:0000250|UniProtKB:Q9H040"; METAL 347; /note="Zinc 2"; /evidence="ECO:0000255|PROSITE-ProRule:PRU01256"; METAL 350; /note="Zinc 2"; /evidence="ECO:0000255|PROSITE-ProRule:PRU01256"; METAL 362; /note="Zinc 2"; /evidence="ECO:0000255|PROSITE-ProRule:PRU01256"; METAL 366; /note="Zinc 2"; /evidence="ECO:0000255|PROSITE-ProRule:PRU01256" |
| Rhea ID | |
| Cross Reference Brenda |