| IED ID | IndEnz0002001989 |
| Enzyme Type ID | protease001989 |
| Protein Name |
Cyanophycinase EC 3.4.15.6 |
| Gene Name | cphB slr2001 |
| Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Cyanobacteria/Melainabacteria group Cyanobacteria Synechococcales Merismopediaceae Synechocystis unclassified Synechocystis Synechocystis sp. PCC 6803 Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Enzyme Sequence | MPLSSQPAILIIGGAEDKVHGREILQTFWSRSGGNDAIIGIIPSASREPLLIGERYQTIFSDMGVKELKVLDIRDRAQGDDSGYRLFVEQCTGIFMTGGDQLRLCGLLADTPLMDRIRQRVHNGEISLAGTSAGAAVMGHHMIAGGSSGEWPNRALVDMAVGLGIVPEIVVDQHFHNRNRMARLLSAISTHPELLGLGIDEDTCAMFERDGSVKVIGQGTVSFVDARDMSYTNAALVGANAPLSLHNLRLNILVHGEVYHQVKQRAFPRVT |
| Enzyme Length | 271 |
| Uniprot Accession Number | P73832 |
| Absorption | |
| Active Site | ACT_SITE 132; /note=Charge relay system; /evidence=ECO:0000269|PubMed:19591842; ACT_SITE 174; /note=Charge relay system; /evidence=ECO:0000269|PubMed:19591842; ACT_SITE 201; /note=Charge relay system; /evidence=ECO:0000269|PubMed:19591842 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[L-4-(L-arginin-2-N-yl)aspartate](n) + H2O = [L-4-(L-arginin-2-N-yl)aspartate](n-1) + L-4-(L-arginin-2-N-yl)aspartate; Xref=Rhea:RHEA:12845, Rhea:RHEA-COMP:13728, Rhea:RHEA-COMP:13734, ChEBI:CHEBI:15377, ChEBI:CHEBI:137986, ChEBI:CHEBI:137991; EC=3.4.15.6; Evidence={ECO:0000269|PubMed:10429200, ECO:0000269|PubMed:19591842}; |
| DNA Binding | |
| EC Number | 3.4.15.6 |
| Enzyme Function | FUNCTION: Exopeptidase that catalyzes the hydrolytic cleavage of multi-L-arginyl-poly-L-aspartic acid (cyanophycin; a water-insoluble reserve polymer) into aspartate-arginine dipeptides. {ECO:0000269|PubMed:10429200, ECO:0000269|PubMed:19591842}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 35 degrees Celsius. {ECO:0000269|PubMed:10429200, ECO:0000269|PubMed:19591842}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.5. {ECO:0000269|PubMed:10429200, ECO:0000269|PubMed:19591842}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (16); Chain (1); Helix (10); Initiator methionine (1); Mutagenesis (11); Turn (3) |
| Keywords | 3D-structure;Direct protein sequencing;Hydrolase;Protease;Reference proteome;Serine protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 3EN0; |
| Mapped Pubmed ID | 18000013; |
| Motif | |
| Gene Encoded By | |
| Mass | 29,390 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=2.2 uM for cyanophycin (at 30 degrees Celsius and pH 8.0) {ECO:0000269|PubMed:10429200, ECO:0000269|PubMed:19591842}; Note=kcat is 16.5 sec(-1) for cyanophycin.; |
| Metal Binding | |
| Rhea ID | RHEA:12845 |
| Cross Reference Brenda | 3.4.15.6; |