| IED ID | IndEnz0002002003 |
| Enzyme Type ID | protease002003 |
| Protein Name |
Fibrinolytic enzyme NJF EC 3.4.21.- Fragments |
| Gene Name | |
| Organism | Hediste japonica (Polychaete worm) (Neanthes japonica) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Annelida Polychaeta (polychaetes) Errantia Phyllodocida Nereididae (sandworms) Hediste Hediste japonica (Polychaete worm) (Neanthes japonica) |
| Enzyme Sequence | NYLHDTVGRLWGPSRAGLLDGLDWMVGDVQSR |
| Enzyme Length | 32 |
| Uniprot Accession Number | P86330 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by phenylmethanesulfonyl fluoride (PMSF). Not inhibited by EDTA, EGTA, beta-mercaptoethanol, indoacetamide, benzamidine, aprotinin, pepstatin A and trypsin inhibitor. {ECO:0000269|PubMed:19896371}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Plasmin-like serine protease. Has fibrinolytic and fibrinogenolytic but not plasminogenolytic activity. Cleaves after Arg and Lys residues. {ECO:0000269|PubMed:19896371}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 60 degrees Celsius. Activity is stable from 40 to 80 degrees Celsius. {ECO:0000269|PubMed:19896371}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 9.0. Activity is stable from pH 6 to 11 but decreases sharply below pH 6. {ECO:0000269|PubMed:19896371}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (2); Non-terminal residue (2) |
| Keywords | Blood coagulation;Direct protein sequencing;Fibrinogenolytic toxin;Fibrinolysis;Hemostasis;Hemostasis impairing toxin;Hydrolase;Protease;Serine protease;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: The N-terminus is blocked. {ECO:0000269|PubMed:19896371}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,585 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |