| IED ID | IndEnz0002002043 |
| Enzyme Type ID | protease002043 |
| Protein Name |
Granzyme A EC 3.4.21.78 Autocrine thymic lymphoma granzyme-like serine protease CTLA-3 Fragmentin-1 T cell-specific serine protease 1 TSP-1 |
| Gene Name | Gzma Ctla-3 Ctla3 Mtsp-1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MRNASGPRGPSLATLLFLLLIPEGGCERIIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV |
| Enzyme Length | 260 |
| Uniprot Accession Number | P11032 |
| Absorption | |
| Active Site | ACT_SITE 69; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P12544; ACT_SITE 113; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P12544; ACT_SITE 211; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P12544 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins, including fibronectin, type IV collagen and nucleolin. Preferential cleavage: -Arg-|-Xaa-, -Lys-|-Xaa- >> -Phe-|-Xaa- in small molecule substrates.; EC=3.4.21.78; Evidence={ECO:0000250|UniProtKB:P12544}; |
| DNA Binding | |
| EC Number | 3.4.21.78 |
| Enzyme Function | FUNCTION: Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA. {ECO:0000250|UniProtKB:P12544}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Alternative sequence (1); Chain (1); Disulfide bond (4); Domain (1); Glycosylation (2); Propeptide (1); Signal peptide (1) |
| Keywords | Alternative splicing;Cytolysis;Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Secreted;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P12544}. Cytoplasmic granule {ECO:0000250|UniProtKB:P12544}. Note=Delivered into the target cell by perforin. {ECO:0000250|UniProtKB:P12544}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10367905; 10556427; 10570179; 10781587; 10820381; 11497079; 11500834; 11507223; 11884544; 12039912; 12064801; 12115618; 12182457; 12355441; 12594834; 12601154; 12847210; 1354647; 1427867; 14499263; 15061770; 15084164; 15322178; 1535334; 1544892; 15534000; 15567431; 15749851; 15998831; 16116214; 16141072; 16339537; 16541469; 16602821; 16606695; 16618603; 1676978; 16775321; 1682216; 16869802; 17088087; 17116752; 17283185; 17308307; 17540585; 17599099; 17919943; 18064039; 18096765; 18485875; 18606691; 1860869; 18788942; 18951048; 19119023; 19506301; 19525394; 19592578; 19838298; 20018616; 20435891; 20585036; 21248253; 21267068; 21311565; 21450826; 21677750; 21709155; 2179951; 21853094; 22031758; 22674984; 23012479; 2307475; 23084031; 23264653; 23568450; 23744295; 24487434; 24505135; 24840346; 25205813; 25383893; 25428875; 25452549; 25502180; 25526309; 25605735; 25928296; 25990242; 26756195; 27055232; 27343190; 27365293; 27612641; 2784565; 28207896; 28694562; 28733313; 2902233; 29743559; 30135490; 30301918; 3090449; 31293597; 31993061; 3257230; 3257574; 32640217; 32809971; 33664861; 7556064; 7730612; 7734049; 7813805; 7841363; 8198617; 8288218; 8678993; 8828042; 8975706; 8996238; 9119362; 9242702; 9362539; 9882377; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,599 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.78; |