| IED ID | IndEnz0002002065 |
| Enzyme Type ID | protease002065 |
| Protein Name |
High choriolytic enzyme 2 EC 3.4.24.67 Choriolysin H 2 HCE21 Hatching enzyme zinc-protease subunit HCE 2 |
| Gene Name | hceb |
| Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Neoteleostei Eurypterygia Ctenosquamata Acanthomorphata Euacanthomorphacea Percomorphaceae Ovalentaria Atherinomorphae Beloniformes (medakas needlefish and others) Adrianichthyoidei Adrianichthyidae Oryziinae (medakas) Oryzias Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Enzyme Sequence | MNLASSACLLLLFLLGIAQALPVQNEEGHEEGNKEGHGEEGVEEGDEDDFVDFTTRILTSNNNTDQLLLEGDLVAPTNRNAMKCWYNSCFWKKASNGFVVIPYVISSQYSRGEVATIEGAMRAFNGRTCIRFVRRTNEYDFISVVSKNGCYSELGRKGGQQELSLNRGGCMYSGIIQHELNHALGFQHEQTRSDRDSYVRINWQNIIPASAYNFNKHDTNNLNTPYDYSSIMHYGRDAFSIAYGRDSITPIPNPNVPIGQRNGMSRWDITRSNVLYNCR |
| Enzyme Length | 279 |
| Uniprot Accession Number | P31581 |
| Absorption | |
| Active Site | ACT_SITE 179; /evidence=ECO:0000255|PROSITE-ProRule:PRU01211 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of the inner layer of fish egg envelope. Also hydrolysis of casein and small molecule substrates such as succinyl-Leu-Leu-Val-Tyr-|-7-(4-methyl)coumarylamide.; EC=3.4.24.67; |
| DNA Binding | |
| EC Number | 3.4.24.67 |
| Enzyme Function | FUNCTION: Participates in the breakdown of the egg envelope, which is derived from the egg extracellular matrix, at the time of hatching. Thus allowing the newly hatched fish to swim free. HCE binds tightly to the egg envelope while it exerts the choriolytic swelling action. {ECO:0000303|PubMed:1397682}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (3); Domain (1); Glycosylation (1); Metal binding (3); Propeptide (1); Region (1); Signal peptide (1) |
| Keywords | Cytoplasmic vesicle;Disulfide bond;Glycoprotein;Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Signal;Zinc;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Zymogen granule {ECO:0000269|PubMed:1397682}. Note=Stored as proenzymes in the zymogen granules. {ECO:0000305|PubMed:1397682}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 31,490 |
| Kinetics | |
| Metal Binding | METAL 178; /note=Zinc; via tele nitrogen; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01211; METAL 182; /note=Zinc; via tele nitrogen; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01211; METAL 188; /note=Zinc; via tele nitrogen; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01211 |
| Rhea ID | |
| Cross Reference Brenda | 3.4.24.67; |