| IED ID | IndEnz0002002069 |
| Enzyme Type ID | protease002069 |
| Protein Name |
Hemolymph trypsin inhibitor A BPI-type Fragment |
| Gene Name | |
| Organism | Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Amphiesmenoptera Lepidoptera (butterflies and moths) Glossata Neolepidoptera Heteroneura Ditrysia Obtectomera Bombycoidea (hawk-moths) Sphingidae (hawkmoths) Sphinginae (small-eyed sphinx moth) Sphingini Manduca Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) |
| Enzyme Sequence | AGLYKPPNNIESENEVYTGNICFLPLEVGVCRALFFRYGYDPAIKACXEFMYGGCQ |
| Enzyme Length | 56 |
| Uniprot Accession Number | P26226 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Non-terminal residue (1); Sequence uncertainty (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,284 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |