| IED ID | IndEnz0002002395 |
| Enzyme Type ID | protease002395 |
| Protein Name |
Methionine aminopeptidase 2-2 MAP 2-2 MetAP 2-2 EC 3.4.11.18 Peptidase M |
| Gene Name | PTT_01727 |
| Organism | Pyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus) (Drechslera teres f. teres) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta dothideomyceta Dothideomycetes Pleosporomycetidae Pleosporales Pleosporineae Pleosporaceae Pyrenophora Pyrenophora teres Pyrenophora teres f. teres Pyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus) (Drechslera teres f. teres) |
| Enzyme Sequence | MGSKSPEDHRQGPDGGSADTAIAIVNPPKSAAASGLLQGMLEGQDEDGDDDDDEKTGIDLKTNDGAKKKRKRNKKKSKKLSVVQQTSPPRVPLATLFDNQPYPEGQIVDYNVKDDNLQRTTAEELRHLAAVRDMDDDFLKDYRKAAEVHRQVRRYAQAIAKPGVSMTRLAEEIDDGVRALTGHEGLETGDALKAGLAFPTGLCLNHVGAHWTPNAGAKDVILKHDDVLKVDFGVHVNGRIVDSAFTVAANPVYDNLLAAVKAATNTGLEEAGIDARIDHISEAIQEVMESYEVELNGKTIPIKAVRNITGHNILRYRIHGDKQVPFVKTKTDQRMEEGDIFAIETFGSTGKAYLQDDVGVYGYGRNENMNPAVLHQSSAKSLLKTIDANFGTLVFARRQLERLPGVEKYHLGMRTLVNSGLVESYAPLVDIPGSYIAQFEHTVLLRPNCKEIISRGEDY |
| Enzyme Length | 459 |
| Uniprot Accession Number | E3RD74 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 210; /note=Substrate; /evidence=ECO:0000255|HAMAP-Rule:MF_03175; BINDING 319; /note=Substrate; /evidence=ECO:0000255|HAMAP-Rule:MF_03175 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Release of N-terminal amino acids, preferentially methionine, from peptides and arylamides.; EC=3.4.11.18; Evidence={ECO:0000255|HAMAP-Rule:MF_03175}; |
| DNA Binding | |
| EC Number | 3.4.11.18 |
| Enzyme Function | FUNCTION: Cotranslationally removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). {ECO:0000255|HAMAP-Rule:MF_03175}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Binding site (2); Chain (1); Metal binding (7); Region (1) |
| Keywords | Aminopeptidase;Cytoplasm;Hydrolase;Metal-binding;Protease;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_03175}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 50,347 |
| Kinetics | |
| Metal Binding | METAL 231; /note=Divalent metal cation 1; /evidence=ECO:0000255|HAMAP-Rule:MF_03175; METAL 242; /note=Divalent metal cation 1; /evidence=ECO:0000255|HAMAP-Rule:MF_03175; METAL 242; /note=Divalent metal cation 2; catalytic; /evidence=ECO:0000255|HAMAP-Rule:MF_03175; METAL 311; /note=Divalent metal cation 2; catalytic; via tele nitrogen; /evidence=ECO:0000255|HAMAP-Rule:MF_03175; METAL 344; /note=Divalent metal cation 2; catalytic; /evidence=ECO:0000255|HAMAP-Rule:MF_03175; METAL 440; /note=Divalent metal cation 1; /evidence=ECO:0000255|HAMAP-Rule:MF_03175; METAL 440; /note=Divalent metal cation 2; catalytic; /evidence=ECO:0000255|HAMAP-Rule:MF_03175 |
| Rhea ID | |
| Cross Reference Brenda |