| IED ID | IndEnz0002002403 |
| Enzyme Type ID | protease002403 |
| Protein Name |
Light-activated DNA-binding protein EL222 EL222 LOV-HTH DNA-binding protein |
| Gene Name | ELI_04755 |
| Organism | Erythrobacter litoralis (strain HTCC2594) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Alphaproteobacteria Sphingomonadales Erythrobacteraceae Erythrobacter/Porphyrobacter group Erythrobacter Erythrobacter litoralis Erythrobacter litoralis (strain HTCC2594) |
| Enzyme Sequence | MLDMGQDRPIDGSGAPGADDTRVEVQPPAQWVLDLIEASPIASVVSDPRLADNPLIAINQAFTDLTGYSEEECVGRNCRFLAGSGTEPWLTDKIRQGVREHKPVLVEILNYKKDGTPFRNAVLVAPIYDDDDELLYFLGSQVEVDDDQPNMGMARRERAAEMLKTLSPRQLEVTTLVASGLRNKEVAARLGLSEKTVKMHRGLVMEKLNLKTSADLVRIAVEAGI |
| Enzyme Length | 225 |
| Uniprot Accession Number | Q2NB98 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 95; /note=FMN; /evidence=ECO:0007744|PDB:3P7N; BINDING 110; /note=FMN; /evidence=ECO:0007744|PDB:3P7N; BINDING 141; /note=FMN; /evidence=ECO:0007744|PDB:3P7N |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 183..202; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00411 |
| EC Number | |
| Enzyme Function | FUNCTION: Has reversible, light-dependent DNA-binding activity. Upon illumination an internal FMN-protein adduct is formed which changes the protein conformation so that the previously sequestered DNA-binding domain is free to bind DNA. Binds to sequences within in its own promoter when illuminated but not when it has been incubated in the dark. {ECO:0000269|PubMed:21606338}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 77..79; /note=FMN; /evidence=ECO:0007744|PDB:3P7N |
| Features | Beta strand (5); Binding site (3); Chain (1); DNA binding (1); Domain (3); Helix (10); Modified residue (1); Mutagenesis (1); Nucleotide binding (1); Region (1); Turn (1) |
| Keywords | 3D-structure;Chromophore;DNA-binding;FMN;Flavoprotein;Nucleotide-binding;Reference proteome;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 78; /note=S-4a-FMN cysteine; /evidence=ECO:0000305|PubMed:21606338 |
| Post Translational Modification | PTM: FMN binds covalently to cysteine after exposure to blue light, this bond is spontaneously broken in the dark; Cys-78 is 3.9 Angstroms from C4a of FMN in the dark, suggesting this is the adduct that is made. {ECO:0000305|PubMed:21606338}. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 3P7N; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,741 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |