| IED ID | IndEnz0002002439 |
| Enzyme Type ID | protease002439 |
| Protein Name |
Kallikrein-8 hK8 EC 3.4.21.118 Neuropsin NP Ovasin Serine protease 19 Serine protease TADG-14 Tumor-associated differentially expressed gene 14 protein |
| Gene Name | KLK8 NRPN PRSS19 TADG14 UNQ283/PRO322 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG |
| Enzyme Length | 260 |
| Uniprot Accession Number | O60259 |
| Absorption | |
| Active Site | ACT_SITE 73; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 120; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 212; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by a range of serine protease inhibitors including antipain, aprotinin, leupeptin, benzamidine and soybean trypsin inhibitor. {ECO:0000269|PubMed:16337200}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of amide substrates following the basic amino acids Arg or Lys at the P1 position, with a preference for Arg over Lys.; EC=3.4.21.118; Evidence={ECO:0000269|PubMed:16337200}; |
| DNA Binding | |
| EC Number | 3.4.21.118 |
| Enzyme Function | FUNCTION: Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury. {ECO:0000269|PubMed:16337200}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.5. Active from pH 7-10. {ECO:0000269|PubMed:16337200}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Alternative sequence (4); Beta strand (17); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (1); Helix (4); Natural variant (1); Propeptide (1); Sequence conflict (1); Signal peptide (1); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Cytoplasm;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Secreted;Serine protease;Signal;Zymogen |
| Interact With | A8MQ03; P42858; Q92876; Q15323; O76011; Q07627; P60410; P26371; Q7Z3S9; P0DPK4; P50454; P37173; Q8IUH5 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:17761692}. Cytoplasm {ECO:0000269|PubMed:17761692}. Note=Shows a cytoplasmic distribution in the keratinocytes. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..28; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 5MS3; 5MS4; |
| Mapped Pubmed ID | 14749636; 15138549; 16800733; 17178872; 18354391; 19085836; 19125171; 19558318; 20360129; 20424135; 20614312; 20940292; 21988832; 22505524; 24614639; 24705354; 25416956; 25926655; 26099606; 27483364; 28142115; 29505099; 29936485; 30013126; 31371645; 32323843; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,048 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.07 mM for Pro-Phe-Arg-MCA {ECO:0000269|PubMed:16337200}; KM=0.07 mM for Z-Val-Val-Arg-MCA {ECO:0000269|PubMed:16337200}; KM=0.07 mM for Boc-Val-Pro-Arg-MCA {ECO:0000269|PubMed:16337200}; KM=0.10 mM for Boc-Leu-Lys-Arg-MCA {ECO:0000269|PubMed:16337200}; KM=0.10 mM for Boc-Val-Leu-Lys-MCA {ECO:0000269|PubMed:16337200}; KM=0.07 mM for Boc-Phe-Ser-Arg-MCA {ECO:0000269|PubMed:16337200}; Vmax=7.1 umol/min/mg enzyme toward Pro-Phe-Arg-MCA {ECO:0000269|PubMed:16337200}; Vmax=5.4 umol/min/mg enzyme toward Z-Val-Val-Arg-MCA {ECO:0000269|PubMed:16337200}; Vmax=3.9 umol/min/mg enzyme toward Boc-Val-Pro-Arg-MCA {ECO:0000269|PubMed:16337200}; Vmax=2.6 umol/min/mg enzyme toward Boc-Leu-Lys-Arg-MCA {ECO:0000269|PubMed:16337200}; Vmax=1.9 umol/min/mg enzyme toward Boc-Val-Leu-Lys-MCA {ECO:0000269|PubMed:16337200}; Vmax=1.6 umol/min/mg enzyme toward Boc-Phe-Ser-Arg-MCA {ECO:0000269|PubMed:16337200}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.118; |