| IED ID | IndEnz0002002444 |
| Enzyme Type ID | protease002444 |
| Protein Name |
Granzyme M EC 3.4.21.- Met-1 serine protease Hu-Met-1 Met-ase Natural killer cell granular protease |
| Gene Name | GZMM MET1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLARVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSA |
| Enzyme Length | 257 |
| Uniprot Accession Number | P51124 |
| Absorption | |
| Active Site | ACT_SITE 66; /note=Charge relay system; /evidence=ECO:0000269|PubMed:19542453; ACT_SITE 111; /note=Charge relay system; /evidence=ECO:0000269|PubMed:19542453; ACT_SITE 207; /note=Charge relay system; /evidence=ECO:0000269|PubMed:19542453 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Cleaves peptide substrates after methionine, leucine, and norleucine. Physiological substrates include EZR, alpha-tubulins and the apoptosis inhibitor BIRC5/Survivin. Promotes caspase activation and subsequent apoptosis of target cells. {ECO:0000269|PubMed:18523284, ECO:0000269|PubMed:20406824}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (14); Chain (1); Disulfide bond (4); Domain (1); Glycosylation (1); Helix (5); Natural variant (1); Propeptide (1); Signal peptide (1); Turn (3) |
| Keywords | 3D-structure;Apoptosis;Cytolysis;Disulfide bond;Glycoprotein;Hydrolase;Immunity;Innate immunity;Protease;Reference proteome;Secreted;Serine protease;Signal;Zymogen |
| Interact With | Q6NX45 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. Cytoplasmic granule. Note=Granules of large granular lymphocytes. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (4) |
| Cross Reference PDB | 2ZGC; 2ZGH; 2ZGJ; 2ZKS; |
| Mapped Pubmed ID | 12506019; 15028722; 15494398; 16818775; 19103589; 19896187; 20107908; 21059895; 21857942; 21909423; 21979465; 23099853; 24316590; 27133719; 27441655; 279011; 3052276; 32282833; 33953729; 809512; 82604; |
| Motif | |
| Gene Encoded By | |
| Mass | 27,545 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.78;3.4.21.B2; |