IED ID | IndEnz0002002480 |
Enzyme Type ID | protease002480 |
Protein Name |
Haptoglobin Zonulin Cleaved into: Haptoglobin alpha chain; Haptoglobin beta chain |
Gene Name | HP |
Organism | Homo sapiens (Human) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
Enzyme Sequence | MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN |
Enzyme Length | 406 |
Uniprot Accession Number | P00738 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity, and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway. {ECO:0000269|PubMed:21248165}.; FUNCTION: The uncleaved form of allele alpha-2 (2-2), known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens. {ECO:0000269|PubMed:21248165}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Alternative sequence (1); Beta strand (23); Chain (3); Disulfide bond (7); Domain (3); Glycosylation (4); Helix (7); Natural variant (5); Region (1); Sequence conflict (2); Signal peptide (1); Turn (6) |
Keywords | 3D-structure;Acute phase;Alternative splicing;Antibiotic;Antimicrobial;Antioxidant;Direct protein sequencing;Disease variant;Disulfide bond;Glycoprotein;Hemoglobin-binding;Immunity;Reference proteome;Repeat;Secreted;Serine protease homolog;Signal;Sushi |
Interact With | P02647; P02649 |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000269|PubMed:6997877 |
Structure 3D | X-ray crystallography (4) |
Cross Reference PDB | 4WJG; 4X0L; 5HU6; 6TB2; |
Mapped Pubmed ID | 11196644; 11380078; 11427216; 11436564; 11529861; 11564959; 11565553; 11865978; 11865979; 11865982; 11909563; 12018475; 12113290; 12174790; 12187922; 12372461; 12388365; 1252417; 12792358; 12867276; 12938813; 12941730; 12941748; 12942785; 13342742; 13472068; 14597045; 14629808; 14657203; 14711515; 14967153; 15019547; 15049697; 15174051; 15274115; 15306193; 15333469; 15385675; 15448162; 15490286; 15866595; 15960705; 16009149; 16086594; 16123372; 16176058; 16189277; 16224193; 16407342; 16436647; 16637741; 16644889; 16681422; 16879055; 17008602; 17082477; 17087019; 17102136; 17220636; 17275123; 17304451; 17357835; 17426810; 17460152; 17678914; 17764509; 17822661; 17880628; 17910034; 17918239; 18032779; 18075673; 18082523; 18257091; 18258668; 18291005; 18332093; 18413152; 18554871; 18563533; 18583979; 18624398; 18636124; 18691072; 18760271; 18787013; 18848136; 18951869; 18959750; 19074141; 19101688; 19108738; 19131549; 19171342; 19210891; 19259359; 19291877; 19296479; 19296903; 19306859; 19347351; 19356838; 19367581; 19379511; 19402793; 19404920; 19433579; 19440331; 19444643; 19446743; 19455468; 19457062; 19463740; 19472074; 19474129; 19569002; 19569003; 19596235; 19682981; 19720796; 19740759; 19743954; 19751729; 19758344; 19785722; 19801537; 19804773; 19879940; 19913121; 19956848; 20017911; 20064496; 20066028; 20109103; 20351714; 20360068; 20368232; 20371432; 20372805; 20376581; 20444272; 20521439; 20552021; 20587610; 20602615; 20628086; 20822092; 20877498; 20881411; 20926521; 20943062; 20972727; 21053180; 21147083; 21159311; 21224490; 21240070; 21253648; 21262313; 21287512; 21294680; 21296538; 21297956; 21315066; 21316675; 21323605; 21401731; 21434877; 21507405; 21546768; 21555971; 21651321; 21708824; 21748360; 21755356; 21767674; 21866866; 21953030; 21953462; 21986563; 21988832; 22028908; 22098782; 22219064; 22290142; 22300541; 22403646; 22433445; 22447230; 22573378; 22629362; 22731712; 22901189; 22922649; 22939808; 23016887; 23164167; 23223086; 23262373; 23268292; 23272204; 23283045; 23300094; 23312704; 23355407; 23385359; 23389048; 23389049; 23399657; 23420675; 23457771; 23498376; 23536133; 23563546; 23573260; 23638175; 23650620; 23671278; 23701120; 23990521; 24018448; 24075749; 24078632; 24120528; 24130793; 24286083; 24286153; 24342402; 24397393; 24478401; 24497482; 24535155; 24567965; 24576319; 24613938; 24658196; 24807840; 24863583; 24868113; 24974683; 24994788; 25060348; 25096020; 25238913; 25336505; 25366599; 25410714; 25472579; 25493023; 25497229; 25525287; 25527876; 25582460; 25583472; 25628235; 25801896; 25861849; 26005016; 26114833; 26122942; 26171400; 26211665; 26228081; 26348010; 26370551; 26448449; 26496610; 26503433; 26684170; 26783151; 26873173; 26901066; 27028131; 27034286; 27190085; 27248178; 27571879; 27995404; 28008865; 28052004; 28218436; 28285651; 28319108; 28398513; 28451949; 28487337; 28641303; 28758129; 28830235; 28883692; 28900795; 28957356; 28960920; 28982674; 29039222; 29077717; 29079835; 29134616; 29285644; 29287080; 29298491; 29338727; 29772214; 29888289; 30030163; 30189188; 30209774; 30287475; 30366827; 30569313; 30614562; 30625342; 30634984; 30646354; 30727751; 30737047; 30952792; 31034502; 31146758; 31215990; 31529337; 31573976; 31574854; 31819010; 31924654; 31937585; 32029134; 32156606; 32309857; 32385356; 32403394; 32464669; 32753660; 32792581; 32794371; 32870172; 33069930; 33114431; 33278377; 33319684; 33396615; 33616244; 33813281; 33978364; 34032635; 34886280; 4327491; 5135507; 7263686; 7378053; 8387722; |
Motif | |
Gene Encoded By | |
Mass | 45,205 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |