Detail Information for IndEnz0002002480
IED ID IndEnz0002002480
Enzyme Type ID protease002480
Protein Name Haptoglobin
Zonulin

Cleaved into: Haptoglobin alpha chain; Haptoglobin beta chain
Gene Name HP
Organism Homo sapiens (Human)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human)
Enzyme Sequence MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN
Enzyme Length 406
Uniprot Accession Number P00738
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity, and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway. {ECO:0000269|PubMed:21248165}.; FUNCTION: The uncleaved form of allele alpha-2 (2-2), known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens. {ECO:0000269|PubMed:21248165}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Alternative sequence (1); Beta strand (23); Chain (3); Disulfide bond (7); Domain (3); Glycosylation (4); Helix (7); Natural variant (5); Region (1); Sequence conflict (2); Signal peptide (1); Turn (6)
Keywords 3D-structure;Acute phase;Alternative splicing;Antibiotic;Antimicrobial;Antioxidant;Direct protein sequencing;Disease variant;Disulfide bond;Glycoprotein;Hemoglobin-binding;Immunity;Reference proteome;Repeat;Secreted;Serine protease homolog;Signal;Sushi
Interact With P02647; P02649
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..18; /evidence=ECO:0000269|PubMed:6997877
Structure 3D X-ray crystallography (4)
Cross Reference PDB 4WJG; 4X0L; 5HU6; 6TB2;
Mapped Pubmed ID 11196644; 11380078; 11427216; 11436564; 11529861; 11564959; 11565553; 11865978; 11865979; 11865982; 11909563; 12018475; 12113290; 12174790; 12187922; 12372461; 12388365; 1252417; 12792358; 12867276; 12938813; 12941730; 12941748; 12942785; 13342742; 13472068; 14597045; 14629808; 14657203; 14711515; 14967153; 15019547; 15049697; 15174051; 15274115; 15306193; 15333469; 15385675; 15448162; 15490286; 15866595; 15960705; 16009149; 16086594; 16123372; 16176058; 16189277; 16224193; 16407342; 16436647; 16637741; 16644889; 16681422; 16879055; 17008602; 17082477; 17087019; 17102136; 17220636; 17275123; 17304451; 17357835; 17426810; 17460152; 17678914; 17764509; 17822661; 17880628; 17910034; 17918239; 18032779; 18075673; 18082523; 18257091; 18258668; 18291005; 18332093; 18413152; 18554871; 18563533; 18583979; 18624398; 18636124; 18691072; 18760271; 18787013; 18848136; 18951869; 18959750; 19074141; 19101688; 19108738; 19131549; 19171342; 19210891; 19259359; 19291877; 19296479; 19296903; 19306859; 19347351; 19356838; 19367581; 19379511; 19402793; 19404920; 19433579; 19440331; 19444643; 19446743; 19455468; 19457062; 19463740; 19472074; 19474129; 19569002; 19569003; 19596235; 19682981; 19720796; 19740759; 19743954; 19751729; 19758344; 19785722; 19801537; 19804773; 19879940; 19913121; 19956848; 20017911; 20064496; 20066028; 20109103; 20351714; 20360068; 20368232; 20371432; 20372805; 20376581; 20444272; 20521439; 20552021; 20587610; 20602615; 20628086; 20822092; 20877498; 20881411; 20926521; 20943062; 20972727; 21053180; 21147083; 21159311; 21224490; 21240070; 21253648; 21262313; 21287512; 21294680; 21296538; 21297956; 21315066; 21316675; 21323605; 21401731; 21434877; 21507405; 21546768; 21555971; 21651321; 21708824; 21748360; 21755356; 21767674; 21866866; 21953030; 21953462; 21986563; 21988832; 22028908; 22098782; 22219064; 22290142; 22300541; 22403646; 22433445; 22447230; 22573378; 22629362; 22731712; 22901189; 22922649; 22939808; 23016887; 23164167; 23223086; 23262373; 23268292; 23272204; 23283045; 23300094; 23312704; 23355407; 23385359; 23389048; 23389049; 23399657; 23420675; 23457771; 23498376; 23536133; 23563546; 23573260; 23638175; 23650620; 23671278; 23701120; 23990521; 24018448; 24075749; 24078632; 24120528; 24130793; 24286083; 24286153; 24342402; 24397393; 24478401; 24497482; 24535155; 24567965; 24576319; 24613938; 24658196; 24807840; 24863583; 24868113; 24974683; 24994788; 25060348; 25096020; 25238913; 25336505; 25366599; 25410714; 25472579; 25493023; 25497229; 25525287; 25527876; 25582460; 25583472; 25628235; 25801896; 25861849; 26005016; 26114833; 26122942; 26171400; 26211665; 26228081; 26348010; 26370551; 26448449; 26496610; 26503433; 26684170; 26783151; 26873173; 26901066; 27028131; 27034286; 27190085; 27248178; 27571879; 27995404; 28008865; 28052004; 28218436; 28285651; 28319108; 28398513; 28451949; 28487337; 28641303; 28758129; 28830235; 28883692; 28900795; 28957356; 28960920; 28982674; 29039222; 29077717; 29079835; 29134616; 29285644; 29287080; 29298491; 29338727; 29772214; 29888289; 30030163; 30189188; 30209774; 30287475; 30366827; 30569313; 30614562; 30625342; 30634984; 30646354; 30727751; 30737047; 30952792; 31034502; 31146758; 31215990; 31529337; 31573976; 31574854; 31819010; 31924654; 31937585; 32029134; 32156606; 32309857; 32385356; 32403394; 32464669; 32753660; 32792581; 32794371; 32870172; 33069930; 33114431; 33278377; 33319684; 33396615; 33616244; 33813281; 33978364; 34032635; 34886280; 4327491; 5135507; 7263686; 7378053; 8387722;
Motif
Gene Encoded By
Mass 45,205
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda