| IED ID | IndEnz0002002582 |
| Enzyme Type ID | protease002582 |
| Protein Name |
L-Ala--D-Glu endopeptidase EC 3.4.-.- Peptidoglycan hydrolase Sporulation-specific endopeptidase |
| Gene Name | lytH yunA yutA BSU32340 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MKVLLSALLLLLFAFEPSASGKKLSDPVLSKRMELYHKIEAVTQIPWYALAAVDQYEENVRSNRKDLPEKAGIISIYIPDDIWSGPENPNPKDDAPLSIKVFDGIGMDGDGDGKAEVSNDEDILYTFSQYLLSYGTDEDNIRIGLWNYYRRDQTVGIISEFMKLFKAYGHIDLGEHAFPLPIRTDYSYRSTWGDARGFGGRRIHEGTDIFAHYGLPVKSTCYGVVEMKGWNRFGGWRIGIRDINNTYHYFAHLNGFAKGIKTGQIVEPGQVIGSVGSSGYGPPGTAGKFPPHLHYGMYKDNGRTEWSFDPYPHLRAWERYEYQKKK |
| Enzyme Length | 326 |
| Uniprot Accession Number | O32130 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: L-Ala--D-Glu endopeptidase involved in production of single L-alanine side chains from tetrapeptides in the spore cortex peptidoglycan. Therefore, is required for the endospore cortex maturation. {ECO:0000269|PubMed:12813075}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Metal binding (4); Signal peptide (1) |
| Keywords | Cell cycle;Cell wall biogenesis/degradation;Differentiation;Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Signal;Sporulation;Zinc |
| Interact With | |
| Induction | INDUCTION: Expressed under the control of the late mother cell-specific sigma factor sigma-K. {ECO:0000269|PubMed:12813075}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 36,957 |
| Kinetics | |
| Metal Binding | METAL 204; /note=Zinc; /evidence=ECO:0000250; METAL 208; /note=Zinc; /evidence=ECO:0000250; METAL 292; /note=Zinc; /evidence=ECO:0000250; METAL 294; /note=Zinc; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |