IED ID | IndEnz0002002587 |
Enzyme Type ID | protease002587 |
Protein Name |
Glycyl-glycine endopeptidase LytM EC 3.4.24.75 Autolysin LytM |
Gene Name | lytM SA0265 |
Organism | Staphylococcus aureus (strain N315) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain N315) |
Enzyme Sequence | MKKLTAAAIATMGFATFTMAHQADAAETTNTQQAHTLMSTQSQDVSYGTYYTIDSNGDYHHTPDGNWNQAMFDNKEYSYTFVDAQGHTHYFYNCYPKNANANGSGQTYVNPATAGDNNDYTASQSQQHINQYGYQSNVGPDASYYSHSNNNQAYNSHDGNGKVNYPNGTSNQNGGSASKATASGHAKDASWLTSRKQLQPYGQYHGGGAHYGVDYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIGNQYAVDPTSYLQSR |
Enzyme Length | 316 |
Uniprot Accession Number | Q7A7T0 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of the -Gly-|-Gly- bond in the pentaglycine inter-peptide link joining staphylococcal cell wall peptidoglycans.; EC=3.4.24.75; |
DNA Binding | |
EC Number | 3.4.24.75 |
Enzyme Function | FUNCTION: Peptidoglycan hydrolase (autolysin) specifically acting on polyglycine interpeptide bridges of the cell wall peptidoglycan. {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Compositional bias (1); Metal binding (4); Region (1); Signal peptide (1) |
Keywords | Cell wall biogenesis/degradation;Hydrolase;Metal-binding;Metalloprotease;Protease;Secreted;Signal;Virulence;Zinc;Zymogen |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000250 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 34,302 |
Kinetics | |
Metal Binding | METAL 117; /note=Zinc; /evidence=ECO:0000250; METAL 210; /note=Zinc; /evidence=ECO:0000250; METAL 214; /note=Zinc; /evidence=ECO:0000250; METAL 293; /note=Zinc; /evidence=ECO:0000250 |
Rhea ID | |
Cross Reference Brenda |