IED ID | IndEnz0002002599 |
Enzyme Type ID | protease002599 |
Protein Name |
Leukocyte elastase inhibitor C Serine protease inhibitor EIC Serpin B1c |
Gene Name | Serpinb1c |
Organism | Mus musculus (Mouse) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
Enzyme Sequence | MGQLSSANNLFALELFHTLNESNPTGNTIFSPVSISSALAMVYLGARGSTAAQLSKTLHFDSAEDIHSQFQSLTAEVSKRGASHTLKLANRLYGEKTYNFLPEYLASIQKTYSADLALVDFQHASEDARKEINQWVKGQTEEKIQELFAVGVVDSMTKLVLVNATYFKGMWQKKFMARDTTDAPFRLSKKVTKTVKMMYLKNNLPFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDETTGLEEIEKQLTLEKLQECENLQNIDVCVKLPKFKMEESYILNSNLGQLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSYVEVNEEGTETDAAMPGTVVGCCLMPMEFTVDHPFLFFIRHNPTAHVLFLGRVCSP |
Enzyme Length | 375 |
Uniprot Accession Number | Q5SV42 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Regulates the activity of the neutrophil proteases. Forms only a stable complex with CTSG/Cathepsin G (By similarity). During inflammation, limits the activity of inflammatory caspases CASP1 and CASP4 by suppressing their caspase-recruitment domain (CARD) oligomerization and enzymatic activation (PubMed:30692621). {ECO:0000250|UniProtKB:Q8VHP7, ECO:0000269|PubMed:30692621}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Erroneous gene model prediction (1); Sequence conflict (1); Site (1) |
Keywords | Cytoplasm;Protease inhibitor;Reference proteome;Serine protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 11863365; 15611268; 21267068; 34830471; |
Motif | |
Gene Encoded By | |
Mass | 41,920 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |