| IED ID | IndEnz0002002607 |
| Enzyme Type ID | protease002607 |
| Protein Name |
Aspartic protease inhibitor 7 Cathepsin D inhibitor p749 |
| Gene Name | |
| Organism | Solanum tuberosum (Potato) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) |
| Enzyme Sequence | MMKCLFLLCLCLFPILVFSSTFTSQNPINLPSESPVPKRVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSGANIFEDQLLNIQFNIPTVKLCGSYTIWKVGNINAHLRTMLLETGGTIGQADSSYFKIVKSSKFGYNLLYCPLTRHFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENPLDVLFQEV |
| Enzyme Length | 221 |
| Uniprot Accession Number | Q41448 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of cathepsin D (aspartic protease). May also inhibit trypsin and chymotrypsin (serine proteases). Protects the plant by inhibiting proteases of invading organisms. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Glycosylation (1); Motif (1); Propeptide (1); Signal peptide (1); Site (2) |
| Keywords | Aspartic protease inhibitor;Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Serine protease inhibitor;Signal;Vacuole |
| Interact With | |
| Induction | INDUCTION: By wounding. Also expressed in upper non-wounded systemic leaves. {ECO:0000269|Ref.2}. |
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 26..31; /note=Vacuolar targeting signal; /evidence=ECO:0000250 |
| Gene Encoded By | |
| Mass | 24,485 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |